78% Američanů věří v nějakou formu kreacionismu

Autor | 06.06. 2012

pic via: disorientedtheology.wordpress.com

Podle výsledků nedávného průzkumu Gallupova ústavu si celých 78 procent obyvatel USA myslí, že bůh nějakým způsobem zasáhl do vývoje člověka. 46% Američanů věří, že bůh stvořil člověka v současné podobě někdy před 10 000 lety, 32% Američanů věří, že se člověk vyvinul pod vedením boha, a pouhých 15% zastává evoluci bez božího zásahu. Od roku 1982, odkdy je tento průzkum prováděn, zůstávají výsledky víceméně stejné.

Asi jedinou možná překvapující zajímavostí potom je, že i když s roustoucím vzděláním počet kreacionistů klesá a stoupá počet zastánců evoluce v neodarwinistické podobě, jak ji dnes chápeme, mezi lidmi s doktorským titulem je nejpopulárnější názor, že se člověk vyvinul bohem řízeným procesem, což odpovídá inteligentnímu designu (ID), který já někdy nazývám „kreacionismem light“.

h/t: Slávek

116 thoughts on “78% Američanů věří v nějakou formu kreacionismu

  1. Pingback: Protestantští pastoři v USA jsou ráznými odpůrci evoluce | Občanské sdružení ateistů České republiky

  2. Medea

    „Škoda že na otázku ohledně vzniku dlouhého funkčního kódu žádný zastánce evoluční teorie adekvátně neodpoví.“

    Pokiaľ sa pýtate na abiogenézu, tak vznik života na Zemi nie je dosiaľ vedecky objasnený, ale existujú plauzibilné hypotézy, ako to mohlo byť.

    A vznik funkčného kódu z iného funkčného kódu vysvetľuje evolučná biológia – mutácie, selekcia, a iné evolučné mechanizmy, menia jeden funkčný kód na iný funkčný kód, resp. na iné funkčné kódy (v prípade vetvenia).

  3. ateista

    Tak tady se mi to zobrazuje, na mobilu mi to nějak blbne a dlouhé diskuze se mi prostě sekají. Takže na Otázky a odpovědi nemohu z mobilu a pc u sebe nemam.

    Takže co jsem psal jinde k Ind.ovi:

    Věda relativně pravděpodobné a poměrně dobře ověřené teorie má ohledně dlouhého funkčního genetického kódu. Jmenuje se to neodarwinismus.

    1) Vznik života: poměrně dobrá indície je Millerův experiment a samovolný vznik bílkovin, dále je to dlouhý čas, kdy se mohou dát dohromady, fyzika tomu nepřekáží a dlouhý čas tomu přispěje.

    2) První genetické kódy byly zjevně o hodně jednodušší než ty dnešní jednoduché, viz. nálezy a také celý princip evoluce. Jak psala Medea, když je něco hodně jednoduché, tak zjednodušení ještě větší znamená smrt, takže tahle část zemřela a zbytek se zesložitil v důsledku mutací a lépe se také rozmnožil, pokud mutace byly pozitivní, u negativních to znamenalo smrt nebo pravděpodobné vymření, neutrální mutace jsou neutrální z hlediska přežití, těch bude asi nejvíc (možná je nejvíc mírně negativních nebo hodně negativních mutací, nevím, jak v kterém případě).

    3) Zbytek mutace a přírodní výběr, zesložitění organismu v průběhu času.

  4. ateista

    Takže ohledně vzniku jsou to zatím jen částečně ověřené hypotézy, ohledně zesložitění je to dobře ověřený neodarwnismus.

    K tomu „Encode“, jelikož je Ind ve skutečnosti Da-niel B. a ten už tuto debatu s námi vedl tisíckrát a vždy prohrál, dávám odkaz kde už se to řešilo s S.V.H a Colombem:

    http://www.osacr.cz/2016/04/22/kreacionismus-je-nabozensky-extremismus-ale-proc/

    Jinak Ind je zastánce toho, že je Země stará jen pár desítek tisíc let, což je v rozporu s moderní vědou, astronomií, biologií, geologií atd..

    Věří na doslovnost Bible i na potopu světa a vodu která sahá pod vrchol Araratu 3km nad dnešní hladinou moře atd..

  5. ateista

    „Colombo
    26.04. 2016

    ENCODE není nesmysl. Ale ENCODE byl odhalen z úmyslné šířené nepravdy o aktivitě DNA a kritizován vědeckou obcí. Stačí si přečíst tu pitomou wikipedii.

    Jako obvykle, kreacionisti stále znovu vytahují dávno vyvrácený omyl.“

    „@ Da-niel B.:
    Nediskutoval jste náhodou na i-ateismu pod nickem Du-nbee? Mám totiž mohutné déja vu. Homo naledi, C14 v dinosauřích fosiliích, ENCODE – to všechno vytahoval také (dokonce se stejnými odkazy). Ale je možné, že podobnost je čistě náhodná – kreacionisté mají jen několik málo „objevů“, které považují za problematické pro ET, a neustále je omílají dokola a dokola (i po opakovaném vyvrácení či vysvětlení).“

    http://www.osa—–cr.cz/2016/04/22/kreacionismus-je-nabozensky-extremismus-ale-proc/

    🙂 Ahoj!

  6. ind

    @Medea

    A vznik funkčného kódu z iného funkčného kódu vysvetľuje evolučná biológia

    Tak mi prosím vysvětlete možný vznik šifrování pomocí RNA, které vědci nedávno objevili.

    Encrypted messages in biological processes
    RNA modifications can encrypt the RNA code and are responsible for a very sophisticated control of RNA function. A new study shows that modified RNA bases have a great impact on the dynamics of gene expression from DNA to functional RNA.

    More than a hundred RNA modifications have been identified with roles in both inhibiting and facilitating binding to proteins, DNA and other RNA molecules. This encryption by RNA modification is a way to prevent the message of the RNA in being read by the wrong recipients.

    www_sciencedaily_com/releases/2018/06/180620094734.htm

    Prosím o teoretický model, jakým způsobem se dá pomocí evoluce dojít k šifrovaným RNA, aby je nepřečetl nesprávný příjemce.

    Šifrování dle ateistů tedy není pouze dílem inteligence. 🙂

  7. ateista

    Teoretický model je neodarwinismus. 🙂

    Náhodné mutace a přírodní výběr, resp. pohlavní výběr. Postupné zesložitění za miliardy let vývoje. Ostatně si všimni, že pokud je tvůj objev skutečný a ne nějaký „křesťanský výzkum“, tak to neudělalo revoluci v evoluční biologii, čím to? 🙂

    Ahoj a někdy! 🙂

  8. ateista

    Všimnul jsi si, Inde, že tvá „mladá Země“ je v rozporu s geologií a vývojem kontitentů a astronomií a fyzikou, kdy trvá hodně dlouho než se zformuje planeta kolem hvězdy? A také s ostatními příbuznými obory? To samé velká potopa světa. 🙂

    Jestli to samozřejmě není všechno jen simulace a ďábel nezakryl stopy. Ale takový bůh, která nás nechá mást, to není moc etické, že? Samozřejmě dám přednost tomu, co jde aspoň částečně ověřit a dnešní věda říká, že taková potopa světa nebyla a Země je mnohem starší. Pokud mě mate bůh, tak má smůlu, já se budu držet dostupných „faktů“.

    Proč vlastně Bible a ne Korán nebo Ferda Mravenec?

    A teď zdar! 🙂

  9. ind

    @ateista

    V DNA nekódující proteiny byly objeveny části obrovsky složité struktury. Už se těším na další objevy programátorských láhůdek.

    Před nějakým časem bylo objeven dvojí kód na tomtéž úseku DNA, což je skvělé. Je to něco jako bychom měli jazyk, který lze významově používat dvojím způsobem.

    Nyní … velmi složité šifrování genetického kódu.

    Nějak vám těch složitostí, na které nemáte, evolucionisté, odpověď, přibývá.
    Víte, že kdo se směje naposled, ten se směje nejlíp. Začínáte tahat za kratší konec provazu. 🙂

  10. ateista

    Samovolné šifrování v přírodě existuje podle neodarwinismu. Mimikry jsou druh šifer. Například. Je to informace, kterou rozpoznají určité druhy. Například různé barvy jsou znaky které rozpoznají určitá zvířata, jiná ne.

    Jinak by mě stále zajímalo toto:

    Všimnul jsi si, Inde, že tvá „mladá Země“ je v rozporu s geologií a vývojem kontitentů a astronomií a fyzikou, kdy trvá hodně dlouho než se zformuje planeta kolem hvězdy? A také s ostatními příbuznými obory? To samé velká potopa světa.

    Jestli to samozřejmě není všechno jen simulace a ďábel nezakryl stopy. Ale takový bůh, která nás nechá mást, to není moc etické, že? Samozřejmě dám přednost tomu, co jde aspoň částečně ověřit a dnešní věda říká, že taková potopa světa nebyla a Země je mnohem starší. Pokud mě mate bůh, tak má smůlu, já se budu držet dostupných „faktů“.

    Proč vlastně Bible a ne Korán nebo Ferda Mravenec?

    Zdravím a hezký víkend všem. 🙂

  11. ind

    @ateista

    Samovolné šifrování v přírodě existuje podle neodarwinismu.

    Všiml sis, ateisto, jak to šifrování v RNA funguje? To není nějaké samovolné šifrování. To šifrování musí být někde zapsáno v DNA, aby přečtená DNA byla zašifrována tak, aby si ji přečetl ten správný příjemce.
    To jednoznačně ukazuje na záměr.

    To, co tu předvádíš, je povrchní přístup, kterým mi jen ukazuješ, že nad danými věcmi pořádně nepřemýšlíš.

    Stejně tak, pokud někomu na internetu posíláš zašifrovanou zprávu, musíš ji zašifrovat tak, aby ji přečetl příjemce, kterému je určena, ne někdo jiný.

  12. Medea

    A vznik funkčného kódu z iného funkčného kódu vysvetľuje evolučná biológia

    „Tak mi prosím vysvětlete možný vznik šifrování pomocí RNA, které vědci nedávno objevili.“

    To som nemala na mysli. Pod „vznikom funkčného kódu z iného funkčného kódu“ som myslela vznik nového génu/génov z génu starého. Je ťažké Vám rozumieť, keď používate príliš všeobecné vyjadrenia.

    Vznik bunky stále nie je doriešený, viď abiogenézu hore. Ale ja na presvedčení, že pozemské bunky vznikli samovoľne, nič iracionálne nevidím. Viď http://planetopia.cz/_kreace/biologie/pravdepodobnost-abiogeneze.html

  13. Medea

    Pojďme tedy hrát s kreacionisty jejich hru a podívejme se na vytvoření peptidu pouhou náhodou přidáváním aminokyselin. Sice to není způsob jakým vznikly peptidy na Zemi, ale bude to ilustrativní.
    Použiji jako příklad sebereplikující peptid ze skupiny Ghadiri jmenované výše 7. Mohu použít jiný příklad, jako třeba sebereplikující hexanucleotide 10, SunY sebereplikátor 24 nebo RNA polymerázu popsanou Ecklandem 12, ale pro historickou návaznost s kreacionistickým tvrzením jsem zvolil peptid. Tento peptid se skládá ze 32 aminokyselin se sekvencí RMKQLEEKVYELLSKVACLEYEVARLKKVGE a je to enzym. Peptid ligáza, která vytváří sama sebe ze dvou šestnácti aminokyselinových podjednotek. Je to také velikost a kompozice, která může ideálně sedět pro vytvoření syntézou abiotických peptidů. Fakt, že se jedná o sebereplikátor je přidáno jen jako třešnička na dortu.
    Pravděpodobnost vzniku náhodnými pokusy je (1/20)^32 nebo šance jedna ku 4,29×10^40. Je to mnohem mnohem pravděpodobnější než jedna ku 2,04×10^390, kterou uvádí kreacionisté jako „vytvoření karboxypeptidáze pouhou náhodou“, ale stále je to šance absrudně malá.
    Nicméně je zde jiná strana pravděpodobnostních odhadů. Závisí na faktu, že většina z nás nemá cit pro statistiky. Když někdo řekne, že se něco stane s pravděpodností jedna ku milionu, mnoho z nás očekává, že musí projít všech milion pokusů, aby se ta určitá událost skutečně stala. Ovšem to je chyba.
    Zde je jeden experiment. Vezměte minci (hlava-orel), hodtě ji čtyřikrát, zapiště si výsledky a udělejte to znovu. Kolikrát si myslíte, že budete muset opakuvat tuto proceduru, abyste hodili čtyři hlavy v řadě.
    Pravděpodobnost že hodíte čtyři hlavy v řadě je (1/2)^4 nebo 1 ku 16. Musíme skutečně hodit 16krát, abychom dostali čtyři hlavy v řadě (HHHH)? Ne. Výsledky, které jsem obdržel, byly 11, 10, 6, 16, 1, 5 a 3 pokusy než jsem hodil HHHH. Šance 1 ku 16 (nebo 1 ku milionu nebo 1 ku 1040) dává pravděpodobnost události v daném pokusu, neříká však kdy požadovaná situace nastane. Můžete hodit HHHH hned na první pokus (mě se to povedlo). Dokonce i šance 1 ku 4,29×1040, sebereplikátor se může objevit překvapivě rychle. Ale je toho ještě víc.
    Šance 1 ku 4,29×10^40 je stále mizivá a velmi nepravděpodobná. Je těžké nakládat s tak velkým číslem. Dokonce i s výše uvedeným arugmentem (můžete to získat hned na prvních pokus) většina lidí řekne „jistě, to by trvalo mnohem déle než existuje samotná Země, pokud by se měl vytvořit tento replikátor pouhou náhodou“. Ne tak docela. V experimentech výše jsme házeli po sobě jdoucími pokusy. Je to jako by každý jeden protein/DNA/proto-replikátor byl vytvářen jednou za jeden cyklus. Ve skutečnosti by tu byly miliardy současných pokusů jako jsou miliardy molekul v oceánu nebo tisíce kilometrů pobřežních čar, které mohou být vhodné pro katalytické děje 2,15.
    Vrame se k našemu experimentu s mincí. Řekněme, že trvá minutu než hodíme mince čtyřikrát. K hození HHHH by nám stačilo v průměru osm minut. Nyní si přiveďme 16 přátel, každého s mincí proto, aby všichni hodili čtyřikrát. Průměrný čas potřebný k vygenerování HHHH je teď jedna minuta. Teď se pokusme hodit 6 hlav v řadě. Pravděpodobnost je nyní (1/2)6 nebo šance 1 ku 64. Teď to potrvá průměrně půl hodiny. Běžte však ven a přiveďte 64 lidí a můžete toho docílit za minutu. Pokud chcete hodit sekvenci s šancí 1 ku miliardě, naverbujte obyvatele Číny, aby každý z nich hodil mincí. Dostanete požadovanou sekvenci hned po prvních dokončených hodech.
    Takže pokud je v naší prebiotické Zemi miliarda peptidů rostoucích současně, značně to redukuje čas potřebný pro vytvoření hledaného replikátoru.
    Dobrá, znovu se podíváme na naše číslo. Šance 1 ku 4,29×10^40. To je velké číslo. Ačkoliv miliarda molekul je hodně molekul, můžeme obdržet dostatek molekul pro náhodné sestavení prvního replikátoru dříve než za půl miliardy let?
    Ano. Jeden kilogram aminokyseliny arginine obsahuje 2,85×1024 molekul (to je dobře přes miliardu miliard). Tuna argininu obsahuje 2,85×1027 molekul. Když vezmete náklaďák každé aminokyseliny a vylejete ho do středně velkého jezírka, dostanete dostatek molekul pro vytvoření našeho konkrétního replikátoru během několika desítek let díky tomu, že bílkovinu o délce 55 aminokyselin získáte během jednoho nebo dvou týdnů 14,16.
    Jak toto všechno zapadá do prebiotické Země? Oceán na Zemi mohl obsahovat asi 1×1024 litrů. S koncentrací 1×10^-6 M (středně zředěná polévka, viz Chyba a Sagan 1992 [23]) je tu zhruba 1×10^50 potenciálních šancí, aby vznikl peptid ligáza (asi 1×10^31), což by trvalo něco pod jeden rok, natož pak za milion let. Syntéza primitivního sebereplikátoru by mohla nastat relativně rychle i s pravděpodobností 1 ku 4,29×10^40 (a pamatujte na to, že požadovaný replikátor může vzniknout hned v prvním pokusu).
    Předpokládejme, že vytvoření sekvence trvá týden 14,16. Potom Ghadiri ligáza může být vygenerována za týden a jákakoliv sekvence cytochromu C může být vygenerována za něco málo přes jeden milion let.
    Ačkoliv jsem použil jako příklad Ghadiri ligázu, jak jsem se zmínil dříve, lze tento proces také použít pro SunY samoreplikátor nebo pro Ekland RNA polymerázu.

    http://planetopia.cz/_kreace/biologie/pravdepodobnost-abiogeneze.html

  14. Medea

    doplňte si mocniny tam, kde chýbajú, niektoré som prehliadla a nedoplnila (v článku chýbali)

  15. toli

    K článku
    Když 78% Američanů jsou kostelní myši tak je celkem logické že si do svého světonázoru musí nějakým způsobem zabudovat kreacionismus.Na tom nevidím nic zvláštního.Když není zhůry dáno v apatyce nekoupí…

  16. Medea

    „Šifrování dle ateistů tedy není pouze dílem inteligence.“

    Ind, je dosť kresťanských vedcov, veriacich, že Boh najprv dovolil samovoľný vznik a vývoj života, a až neskôr, pri pokročilejších živočíšnych formách, nasmeroval evolúciu k človeku a dotvoril, pomocou nesmrteľnej duše, človeka na svoj obraz 🙂

  17. Foxy

    Zdravím Tě, Medeo! Jsem rád, že stále ještě jsi.

  18. Medea

    Ďakujem Foxy, aj ja som rada, že sme stále spolu v tomto vesmíre 🙂

  19. Medea

    Ind, aká je pravdepodobnosť samovoľného vzniku jednobunkového života na pravekej Zemi vypočítať neviete.

    A keby ste sa aj k tej pravdepodobnosti dopracovali, a bola kladná, tak neviete, koľko takých planét ako naša Zem bolo pred 4.5 miliardami rokov vo vesmíre.

    Pokiaľ je vesmír homogénny a veľmi veľký, tak by ich počet mohol viesť k tomu, že pravdepodobnosť skorého vzniku života na aspoň jednej takejto planéte, by bola vzhľadom na celý vesmír veľká (mnoho nezávislých pokusov).

    A pokiaľ by bol vesmír nekonečný a homogénny, tak by dokonca bola rovná 1 (nekonečne mnoho planét podobných Zemi, nekonečne mnoho nezávislých náhodných pokusov pre skorý vznik života —> aplikovať 2. Borelovu – Cantelliho lemu) pre náhodný jav: skorý vznik na nekonečne mnoho takýchto planétach.

    Teda iracionálnosť ľudí, ktorí veria v samovoľný vznik života v našom vesmíre sa Vám nepodarilo ukázať.

  20. Jaroslav Štejfa

    K indovi:
    Zaměňujete zde (nevím zda z nevědomosti nebo poťouchlosti) pojmy „kód“ – což je způsob jak zapsat informaci na nějaké medium a „šifra“ což je výsledek metody cíleného utajení zprávy (informace). Váš přístup je, řečeno mírně, matoucí. Nedovedete se asi oprostit od myšlenky tvůrce světa, který má manii před člověkem stále něco utajovat. Ale veškeré poznatky o evoluci zásadně hovoří o netečnosti okolního světa k našim vědomostem o něm z hlediska zda něco víme či ne. Vaše námitky jsou prostě liché. Typická je Bible – samý jinotaj, samá šifra, pokud však nerozumíte svahilsky, není to pravděpodobně proto, že to před vámi někdo tají; prostě se to naučte. Ovšem přišli bychom o vzrušivé dráždění Medey.
    Jaroslav Štejfa

  21. ateista

    Jak píše Jaroslav, to co ty považuješ za „šifru“ může být prostě samovolný mechanismus, který není předem cílený a záměrný, ale postupně vyvinutý od jednoduchého po složitý. Čili to není šifra v běžném lidském významu, ale prostě řekněme „kódování“ nebo možná lépe „rozpoznávání/nerozpoznávání“ – mechanismus postuně vyvinutý bez původního plánu.

    Takže k tomu asi není víc co dodat, tato debata už proběhla v roce 2016 na odkazu, který jsem sem dal. A pak si tam přestal psát, asi si neměl argumenty. Pročti to celé a dej něco nového kdyžtak, tohle už je opakování něčeho již úspěšně zpochybněného několik let zpět.

    Nashle a hezké prázdniny všem! 🙂

  22. antitheista

    Inde, můžeš odpovědět na tu potopu světa a na pár tisíc let starou Zemi? Není to v rozporu s fyzikou jak jí dnes známe? 🙂

  23. Ateistický laik

    k článku: V Americe vidím problém především v přístupu k ateistům, kde není normální (naopak jsou ostrakizováni) se k ateistům hlásit. Takže se tam jedinci jsou „nucení“ se hlásit k nějaké církvi, a pak už je jen malý krůček ke kreacionistům.

    ind: Nyní … velmi složité šifrování genetického kódu.
    A proč si myslíte, že to je šifrování? Jen proto, že to někdo takhle ve vědecké zprávě popsal?
    Já bych řekl (bez nároků na pravdu), že každý druh má vlastní sled kódu v genech, protože se tak právě vyvinul a aby rozpoznal (s velmi velkou pravděpodobností) ty své správné jedince při následném rozmnožování. Protože kdyby tomu tak nebylo, tak by v přírodě docházelo k mezidruhovému párování (teď si vybavuji třeba kůň a osel), kde by vznikaly zmetky neschopné k přežití. A tam kde by jedinci přežili, tak by vznikl nový druh (teď nevím jak by to biologové nazvali). Na tom příkladu s koněm a oslem je vidno, že kontrolní mechanismus nefunguje 100%, ale na druhou stranu se zase mula nebo mezek dál běžně nerozmnožují.

  24. ind

    @Medea

    Když vezmete náklaďák každé aminokyseliny a vylejete ho do středně velkého jezírka, dostanete dostatek molekul pro vytvoření našeho konkrétního replikátoru během několika desítek let díky tomu, že bílkovinu o délce 55 aminokyselin získáte během jednoho nebo dvou týdnů 14,16.

    Zajímalo by mne, jaká je vůbec pravděpodobnost, že vznikne jakákoli 55 aminokyselinová bílkovina, když je známo, že aminokyseliny jsou v bílkovině spojeny peptidovou vazbou a peptidová vazba je přerušitelná hydrolýzou, neboli přítomností vody. 🙂

    A peptide bond can be broken by hydrolysis (the addition of water).
    en_wikipedia_org/wiki/Peptide_bond

    Chtějí sypat aminokyseliny do jezírka pro vytvoření peptidových vazeb, když voda působí na tyto vazby rozkladně? 😀

  25. ind

    @Medea

    Ind, aká je pravdepodobnosť samovoľného vzniku jednobunkového života na pravekej Zemi vypočítať neviete.

    Z hlediska chemie je nulová. To není jen o náhodném generování a uspořádání chemických látek, ale i o možnostech stability těchto látek v daném chemickém prostředí. Stačí se podívat na vznik a stabilitu cytosinu, který se vyskytuje v DNA i RNA. 🙂

  26. ind

    @Jaroslav Štejfa

    Nedovedete se asi oprostit od myšlenky tvůrce světa, který má manii před člověkem stále něco utajovat.

    Sami evolucionisté výrazy šifra a šifrování používají. Ano, jedná se o utajení zprávy, aby byla čitelná pouze určenému příjemci.

    Přeložte si z angličtiny toto:
    Encrypted messages in biological processes
    RNA modifications can encrypt the RNA code and are responsible for a very sophisticated control of RNA function.

    More than a hundred RNA modifications have been identified with roles in both inhibiting and facilitating binding to proteins, DNA and other RNA molecules. This encryption by RNA modification is a way to prevent the message of the RNA in being read by the wrong recipients.

    www_sciencedaily_com/releases/2018/06/180620094734.htm

    Máte stále problém s pojmem šifra vzhledem ke genetickému kódu?

  27. ind

    @ateista

    Jak píše Jaroslav, to co ty považuješ za „šifru“ může být prostě samovolný mechanismus, který není předem cílený a záměrný, ale postupně vyvinutý od jednoduchého po složitý. Čili to není šifra v běžném lidském významu, ale prostě řekněme „kódování“ nebo možná lépe „rozpoznávání/nerozpoznávání“ – mechanismus postuně vyvinutý bez původního plánu.

    Šifra to je z definice…

    Kryptografie neboli šifrování je nauka o metodách utajování smyslu zpráv převodem do podoby, která je čitelná jen se speciální znalostí.
    cs_wikipedia_org/wiki/Kryptografie

    Postupný vývoj je nesmysl. Buď je to zašifrované tak, že to přečte pouze určený příjemce, nebo to mohou přečíst i ti nesprávní a pak nastává problém.
    Kód musí být zašifrovaný CÍLENĚ.

    Je to zřejmé i v tom, že mutace v těchto kryptografických nástrojích vedou ke vzniku ruzných druhů rakoviny.

  28. Ateistický laik

    ind: Ano, jedná se o utajení zprávy, aby byla čitelná pouze určenému příjemci …
    … Máte stále problém s pojmem šifra vzhledem ke genetickému kódu?

    Já třeba mám problém. Prostě češtinsky (překlad) mě to nesedí. Funkčně je to správně.
    Chápete třeba klíč do zámku jako kód, kde je zašifrována správa příjemci (zámku)?

    Postupný vývoj je nesmysl. Buď je to zašifrované tak, že to přečte pouze určený příjemce,
    A je to opravdu zašifrované, nebo prostě kontrolní mechanismus pro vznik buňky pouze mechanicky kopíruje to co bylo, je a bude? A při slučování vajíčka se spermií se to prostě musí v nějakém velkém procentu napárovat.
    nebo to mohou přečíst i ti nesprávní a pak nastává problém.
    A co křížení koně a osla? Tam nastal problém. A myslím, že by se našli i jiné dvojice zvířat, co se páří a výsledek je neplodný (kozoovce).
    Kód musí být zašifrovaný CÍLENĚ.

  29. Jaroslav Štejfa

    K indovi:
    Mám určitý malý problém s vaším přístupem k pojmu šifra.
    1) Tento pojem ve vámi uvedené zprávě ze sciencedaily.com je uveden pouze v komentáři (zřejmě redaktora) webu. Zda samotná vědecká práce toto slovo používá není jasné. Lze to vysvětlit jednoduše – je to pro laiky poměrně vhodná paralela. Z celého textu však plyne jednoznačně, že RNA má nějakou (lidmi pouze částečně poznanou) strukturu, jako ostatně každá hmotná látka v nám známém vesmíru, takže naznačovat, že je v ní skryta šifra (záměrně sloužící k utajení podstaty) je sice možná vzrušivé, však podle mého bláhové a matoucí.
    2) Dále tento pojem, tak jak ho definuje kryptografie či kryptologie, jak jsme se asi shodli, z podstaty vyžaduje účelovou snahu jakési inteligence (zřejmě ve vašem případě té nejvyšší) skrýt nějakou informaci před inteligencí srovnatelnou, s cílem nepoškodit sebe ve svém konání, naopak poškodit onu soupeřící v jejím konání. Protože však (nejvyšší) inteligence – Bůh, podle mne neexistuje, podle vás je bezkonkurenční (protože je tvůrce a řiditel), musíme se logicky shodnout na bezduchosti zašifrovanosti života ve vaší versi.
    3) Notabene zcela jednoznačně- pokud je šifra prolomena, trvá-li šifrant (Bůh?) na svém, musí šifru změnit, nicméně měď se stále rozpouští v kyselině solné a zpráva RNA je čtena správnými příjemci bez ohledu, zda člověk „šifru“ prolomil či ne.
    4) Co před námi šifrant tají, proč to dělá a kdo to je?
    Jaroslav Štejfa

  30. ind

    @Jaroslav Štejfa

    1) Tento pojem ve vámi uvedené zprávě ze sciencedaily.com je uveden pouze v komentáři (zřejmě redaktora) webu.

    Tento text je převzat přímo ze stránek univerzity, přímo na sciencedaily.com je uveden na něj odkaz.
    mbg.au.dk/en/news-and-events/news-item/artikel/encrypted-messages-in-biological-processes/

    Co je pro vás matoucího na tom, že je daná RNA upravena tak, aby byla čitelná pouze pro určené příjemce?
    Řečeno jinak – výsledá RNA je modifikována „zámkem“, který odemkne pouze „klíč“ příjemce. Tento „zámek“ tvoří modifikátory, kterých bylo objeveno už přes 100. V odkazováném článku je řeč o modifikátoru m6A s chemickým vzorcem C11H15N5O4, který modifikuje RNA v různých místech a tak ji chrání před přečtením nesprávnými příjemci.
    Takže pro přečtení dané modifikované RNA potřebujeme m6A vázací proteiny na správných místech, na které se naváže a pak je „odemknuta“.
    Celkově se jedná o velmi složitý proces, protože některé modifikace slouží k potlačení vazeb, zatímco jiné ji umožňují.

    Vy jste z článku nepochopil, co se myslí určenými příjemci?

  31. Jaroslav Štejfa

    K indovi:
    O vašich opsaných vysvětlení chování a uspořádání RNA já neříkám ani popel. Stále na vás dorážím, kde z toto popisu berete přesvědčení, že to všechno spískala nadpřirozená inteligence, kde se tedy vzala a jak to, že je-li ona bájná šifra, kterou není nic a nikdo schopen sestavit (podle vás), je-li prolomena (jak je to vůbec možné?), se ničím nenahradí a stane se banální vědomostí tupých vědců. Jenom uhýbáte. Vše na nám známém světě je upraveno tak, aby bylo čitelné pouze pro určené příjemce. Například svahilština, nebo jízda na kole. Holt tupějším organismům to prostě déle trvá, někdy i déle, než si umí představit.
    Jaroslav Štejfa

  32. ind

    @Jaroslav Štejfa

    Vše na nám známém světě je upraveno tak, aby bylo čitelné pouze pro určené příjemce.

    Vy nerozlišujte mezi zabezpečeným a nezabezpečeným připojením k internetu? 🙂
    Připojil byste se online k bankovnímu účtu pomocí nezabezpečeného připojení?

    Nejsem vůbec přesvědčen, zda chápete, co jsem napsal a nerozumím vašim zmínkám o prolomení šifry. V buňkách k žádnému prolamování a hádání šifer nedochází.
    Zašifrování, onen zámek, slouží pouze k zamezení přečtení nesprávnými příjemci.

    O jakých bájných šifrách zde píšete?

  33. ind

    @Ateistický laik

    A je to opravdu zašifrované, nebo prostě kontrolní mechanismus pro vznik buňky pouze mechanicky kopíruje to co bylo, je a bude?

    Samozřejmě, že to je zašifrované. Představte si to chemicky – RNA je chemická sloučenina. Po přepisu z DNA se na ní na určených místech navážou další různé chemické sloučeniny tak, aby se dala zachytit cílovým příjemcem. Sloučeniny slouží k umožnění a potlačení chemických vazeb.
    Bez těchto sloučenin by RNA mohla být zachycena nesprávným příjemcem a dělalal by něco, co by neměla dělat.

  34. Ateistický laik

    ind: Vy nerozlišujte mezi zabezpečeným a nezabezpečeným připojením k internetu?
    Připojil byste se online k bankovnímu účtu pomocí nezabezpečeného připojení?

    Srovnáváte opětně nesrovnatelné. Já bych to spíš skusil přirovnat k tomu, že bych se pokusil komunikovat s bankou od medvědů, a ta by jednoduše neodpovídala, neb by naznala lidský kód (k přístupu). Jestli je komunikace zabezpečená nebo ne, je irelevantní (představte si komunikaci třeba pomocí XML souboru, kde každý druh má své proměné a hodnoty).

    Samozřejmě, že to je zašifrované.
    A proč by to měla být šifra? Co je tam zašifrované? Prostě u každého druh se vyvinili určitý sled frekvencí s jinými neslučitelné. Zamyslel jse se nak koněm a oslem (nebo jinými druhy)?
    Chápete třeba klíč do zámku jako kód, kde je zašifrována správa příjemci (zámku)?

    Představte si to chemicky – RNA je chemická sloučenina.
    No nepovídejte… 🙂
    Sloučeniny slouží k umožnění a potlačení chemických vazeb.
    A takhle funguje pravděpodobně „celý život“. 🙂 Prachsprostá chemie a fyzika. 🙂

  35. Jaroslav Štejfa

    K indovi:
    Jak jsem očekával, o šifrách zde bájíte vy.
    Jaroslav Štejfa

  36. Medea

    „Zajímalo by mne, jaká je vůbec pravděpodobnost, že vznikne jakákoli 55 aminokyselinová bílkovina, když je známo, že aminokyseliny jsou v bílkovině spojeny peptidovou vazbou a peptidová vazba je přerušitelná hydrolýzou, neboli přítomností vody.“

    Ak Vás to zaujíma, preštudujete si odporúčanú literatúru pod článkom.

    „Chtějí sypat aminokyseliny do jezírka pro vytvoření peptidových vazeb, když voda působí na tyto vazby rozkladně?“

    Ten rozklad je jednak veľmi pomalý, viď Vami citovanú wikipédiu: A peptide bond can be broken by hydrolysis (the addition of water). In the presence of water they will break down and release 8–16 kilojoule/mol (2–4 kcal/mol)[9] of free energy. This process is extremely slow, with the half life at 25C of between 350 and 600 years per bond. A opäť treba pozrieť odporúčanú literatúru pod článkom [14, 16], a dozviete sa tam napr. o úlohe minerálov pri takejto polymerizácii:

    Most theories of the origin of biological organization assume that polymers with lengths in the range of 30-60 monomers are needed to make a genetic system viable‘. But it has not proved possible to synthesize plausibly prebiotic polymers this long by condensation in aqueous solution, because hydrolysis competes with polymerization.The potential of mineral surfaces to facilitate prebiotic polymerization was pointed out long ago. Here we describe a system that models prebiotic polymerization by the oligomerization of activated monomers – both nucleotides and amino acids. We find that whereas the reactions in solution produce only short oligomers (the longest typically being a 10-mer), the presence of mineral surfaces (montmorillonite for nucleotides, illite and hydroxylapatite for amino acids) induces the formation of oligomers up to 55 monomers long. These are formed by successive ‚feedings‘ with the monomers; polymerization takes place on the mineral surfaces in a manner akin to solid-phase synthesis of biopolymers.

    https://ntrs.nasa.gov/archive/nasa/casi.ntrs.nasa.gov/19980119839.pdf

    Ind, aká je pravdepodobnosť samovoľného vzniku jednobunkového života na pravekej Zemi vypočítať neviete.

    „Z hlediska chemie je nulová. To není jen o náhodném generování a uspořádání chemických látek, ale i o možnostech stability těchto látek v daném chemickém prostředí. Stačí se podívat na vznik a stabilitu cytosinu, který se vyskytuje v DNA i RNA. “

    Aj vznik a pretrvávanie sú stochastické procesy, teda nulová nie je. Vy si pletiete nemožnosť s nízkou pravdepodobnosťou.

    Dokonca aj náhodný jav s nulovou pravdepodobnosťou môže byť možný (spojité distribučné funkcie náhodných veličín, nekonečné náhodné polia).

  37. Medea

    „Postupný vývoj je nesmysl. Buď je to zašifrované tak, že to přečte pouze určený příjemce, nebo to mohou přečíst i ti nesprávní a pak nastává problém.“

    Ind, to je čiernobiele videnie sveta 🙂 Na počiatku mohlo byť nejaké nedokonalé šifrovanie, ktoré mohli prečítať aj nesprávny príjemcovia. A postupom času sa, vďaka mutáciám a prirodzenému výberu, šifrovanie zdokonaľovalo až k súčasnej forme.

    Podobné argumenty mali veriaci v 18. storočí ohľadom oka, „keby oko nebolo vytvorené perfektným inžinierom, tak by videnie nebolo možné“, ale opomínali, že medzi úplnou slepotou a ostrým zrakom môže byť celé kontinuum možností 🙂

  38. ind

    @Medea

    Děkuji Medeo, za odkaz. Je v něm jasné potvrzení, že jsem měl v tvrzení o hydrolýze pravdu.

    But it has not proved possible to synthesize plausibly prebiotic polymers this long by
    condensation in aqueous solution, because hydrolysis competes with polymerization.

    https://ntrs.nasa.gov/archive/nasa/casi.ntrs.nasa.gov/19980119839.pdf

    Takže evolucionisté si chtěli hrát hru s kreacionisty s příkladem o vodním jezírku a prohráli. 🙂

  39. ind

    @Jaroslav Štejfa

    Jak jsem očekával, o šifrách zde bájíte vy.

    Pojem šifrování se používá v textu na stránkách univerzity, na kterou jsem zde odkazoval. Je vidět, že oni s tímto pojmem problém nemají, vy ano.

  40. ind

    @Medea

    Aj vznik a pretrvávanie sú stochastické procesy, teda nulová nie je.

    Myslím tím prakticky nulová. Teoreticky nenulová je i pravděpodobnost, že neexistuje žádný řád, žádná zákonitost v přírodě, vše je naprostý chaos a vše se děje náhodně. Vychází to prostě tak, že tyto náhodné procesy se jeví jako zákonitosti. Nevím, jak byste přijmali tvrzení, že neexistují zákonitosti kvantové fyziky, ani Einsteinova teorie relativity. 🙂

  41. ind

    @Medea

    Na počiatku mohlo byť nejaké nedokonalé šifrovanie, ktoré mohli prečítať aj nesprávny príjemcovia.

    A jste o tom skutečně přesvědčena, že na začátku mohlo být šifrování nedokonalé? 🙂

    RNA modification occurs in all living organisms, and is one of the most evolutionarily conserved properties of RNAs
    https://en.wikipedia.org/wiki/RNA_modification

  42. Marek

    Bez souvislosti se vznikem života, je to až pozoruhodné, s jakou lehkostí a suverenitou se zejména nick Ind vyjadřuje o biochemických procesech, zejména o chemii polypeptidů a nukleových kyselin. Zajímalo by mě, do jaké míry se orientuje obecně v chemii, následně pak v chemii makromolekulární. Zda dokáže třeba jen rámcově (nikoliv však jen wikipedicky), avšak srozumitelně říct, jaké jsou třeba obecné charakteristiky jednotlivých fází chemické reakce. Jak je vlastně možné, že reakci lze katalyticky ovlivnit. Co je to vlastně ta iniciace, co propagace, a co terminace, proč, kdy, a taky co je zrovna třeba u polypeptidů nazýváno činidlem a co substrátem, jakou roli hraje disociace, co vůbec disociuje. S tím, co, proč, a zejména jak tyto děje ovlivňuje kvalitativně či kvantitativně. A samozřejmě, jakým způsobem všechny tyto děje lze analyzovat, kdy, kde, a jakou platnost mají údaje neměřitelné, tedy získané dopočtem, odvozením, či extrapolací. A naposledy, proč si myslí, že výzkum je obecně dělen na základní a aplikovaný, a co to konkrétně ve výzkumu chemickém znamená.
    To mne napadlo jen z hlavy, proto je to nesystematické. Bez alespoň rámcových takových znalostí, a bez bezpečné orientace v terminologii však skutečně nelze vyjadřovat se ani o osolení polévky. Mimochodem, ví Ind, co fyzikálního se s tou polévkou stane po tom osolení? Nápovědou je termodynamika…

  43. ind

    @Marek

    Jsem asi někomu šlápl na kuří oko, vypálil jsem evolucionistům rybník, pardon, jezírko s náklaďáky aminokyselin, kde předpokládali vznik mnohonásobných peptidových vazeb navzdory přítomností vody. 🙂

    Chápejte, že čím jsem hloupější, tím větší ostuda pro vás. 🙂

  44. Jaroslav Štejfa

    K indovi:
    Cituji vaši základní premisu této debaty:
    „Může mi někdo z ateistů vysvětlit, kde bere víru v možnost tvorby složitého kódu bez přispění inteligence?
    Já té víry nejsem schopen, neboť je proti zdravému úsudku.“

    Protože nechcete slyšet evoluční vysvětlení (nevím proč), můžeme tedy věc obrátit.
    Můžete nám vysvětlit, kde bere víru v možnost existence nejvyšší inteligence a její tvorbu složitého kódu RNA?

    Já vaší víry nejsem schopen, neboť je proti zdravému úsudku.

    Jaroslav Štejfa

  45. ind

    @Jaroslav Štejfa

    Protože nechcete slyšet evoluční vysvětlení (nevím proč)…

    On to evoluční vysvětlení někdo z evolucionistů má? Setkávám se nanejvýš s jejich fantazií.
    Pokud někdo nabízí nekonkrétní představy a nazývá to vysvětlením, pak se s ním jistě neshodnu.

    Všeobecně vaše vysvětlení je na úrovni vysvětlení vzniku složitého strukturovaného kódu simulací – tedy žádné.

    A vrchol absurdity je přesvědčovat mně pomocí nenulové pravděpodobnosti.

    Můžete nám vysvětlit, kde bere víru v možnost existence nejvyšší inteligence a její tvorbu složitého kódu RNA?

    Nejdříve je potřeba dojít k přesvědčení, že tvorba kódu je všeobecně dílem inteligence.
    Strukturální složitost daného kódu nám může prozradit míru inteligence jejího tvůrce.

    Pokud někdo používá velmi složitý lidský jazyk, nemůže být neinteligentní.

    Neexistuje neinteligentní generátor, který by byl schopný generovat mluvu v neznámém jazyce, kterému bychom byli schopni přiřadit význam.

    Právě víceúrovňová struktura a opakující se vzory a jejich vzájemné vazby nám ukazují na inteligenci.

    Nevím, proč se mnou někdo nesouhlasí v tom, že text literárního díla je schopna vytvořit POUZE inteligence?

    Je to proto, že pozorujeme inteligentní bytosti, jak vytváří texty literárních děl?
    To, že texty literárních děl vytváří inteligentní bytosti přece nic neříká o tom, že neinteligence toho není schopna!

  46. Jaroslav Štejfa

    K indovi:
    Složitý kód RNA – RNA je nukleová kyselina, patří do biogenních látek, jako hromada jiných. Oproti kyselinám je podstatně složitější a samozřejmě je nositelem informace v existenci života. Pokud považujeme život za extrémně složitý proces, je nabíledni, že se tak děje pomocí extrémně složitých struktur. Ale, že byste mě tím přesvědčil potřebě tvůrce – inteligence, je chabé; odborníci ve zkoumání podstaty RNA se nějak o vaší verzi její podstaty zapomínají zmínit.
    Nicméně- nabídl jsem vám diskusi na téma: Ke vzniku složité RNA je třeba inteligence; protože to vy tvrdíte a já tomu nevěřím, doložte to něčím jiným než znova odkazem na vaši nevíru v evoluci. Vaše víra v něco nedoložitelného je nic. Prostě kromě kritiky nás, ateistů hoďte do placu jak a proč ona inteligence RNA vytvořila. Už neuhýbejte. Vy nevěříte mě, já nevěřím vám. I to je konec polemiky. Auditorium si to přebere svým rozumem.
    Jaroslav Štejfa

  47. ind

    @Jaroslav Štejfa

    Samozřejmě, že všude můžeme pozorovat, že inteligence je schopna vytvářet kód.

    Vy věříte, že kód je možno vytvořit bez inteligence, aniž byste to někdy pozoroval, aniž byste byl schopný to nasimulovat, nebo kdokoli jiný.

    Já vám vaší víru v autority nemám v úmyslu brát.
    Ale je vidět, že jste evolucionisté obecně ve svém myšlení snadno oklamatelní, protože vznik delších řetězců polypeptidů ve vodném roztoku jsem zde všichni „sežrali i s navijákem“.

    Základní otázka zní – je k tvorbě kódu nutná inteligence?
    Tvrdím, že ano a jsem schopen to i doložit.

    Je to velmi jednoduché – neexistuje neinteligentní hodnotící metoda, která dokáže zhodnotit kód pro selekci.
    Podobně při hře v šachy neexistuje neinteligentní hodnotící metoda, která zhodnotí na základě stavu rozložení figurek nejvhodnější tah vedoucí k výhře. Pro hodnocení musíme počítat se stavy rozložení figurek, které mohou nastat a tato analýza je výhradně vlastností inteligence.

    Pokud spoléháte na extrémně malou pravděpodobnost,
    věřte si klidně v to, že nastal jev, který měl pravděpodobnost 0,0000000000000000000000000000001%.
    Já zůstavám v přesvědčení, že nastal jev, který měl pravděpodobnost 99,9999999999999999999999999999999%.
    🙂

  48. Petr TomekPetr Tomek

    @Indy: Kreace (tvoření) je popis toho, jak inteligentní jedinec tvoří něco méně složitého. Evoluce je popis procesu při kterém z jednoduššího vzniká složitější. Oba procesy v přírodě pozorujeme. Vy jste se prostě rozhodl, že jeden z nich neexistuje, ale to není starost nikoho na téhle stránce.
    Mimochodem existují stopy ukazující rozdíly mezi věcmi vytvořenými se záměrem a věcmi vzniklými evolucí.
    Ve chvíli, kdy uznáte, že existuje i evoluce, není existence jakýchkoli složitých organických struktur problém. Opakováním stále stejných tvrzení na tom nic nezměníte.

  49. ind

    @Petr Tomek

    Evoluce je popis procesu při kterém z jednoduššího vzniká složitější. Oba procesy v přírodě pozorujeme. Vy jste se prostě rozhodl, že jeden z nich neexistuje, ale to není starost nikoho na téhle stránce.

    Pozorujeme zvyšující informační složitost kódu DNA? Můžete uvést příklad?

  50. Medea

    „Děkuji Medeo, za odkaz. Je v něm jasné potvrzení, že jsem měl v tvrzení o hydrolýze pravdu.
    But it has not proved possible to synthesize plausibly prebiotic polymers this long by
    condensation in aqueous solution, because hydrolysis competes with polymerization.
    https://ntrs.nasa.gov/archive/nasa/casi.ntrs.nasa.gov/19980119839.pdf“

    Ind, to čítanie toho Vami citovaného súvetia Vás tak vyčerpalo, že ste už v článku nevládali prečítať súvetie nasledujúce? 🙂

    The potential of mineral surfaces to facilitate prebiotic polymerization was pointed out long ago. Here we describe a system that models prebiotic polymerization by the oligomerization of activated monomers – both nucleotides and amino acids. We find that whereas the reactions in solution produce only short oligomers (the longest typically being a 10-mer), the presence of mineral surfaces (montmorillonite for nucleotides, illite and hydroxylapatite for amino acids) induces the formation of oligomers up to 55 monomers long. These are formed by successive ‚feedings‘ with the monomers; polymerization takes place on the mineral surfaces in a manner akin to solid-phase synthesis of biopolymers.

    Áno, polymerizácia a hydrolýza pôsobia vo vodnom roztoku proti sebe, a to vedie k tomu, že reťazce vznikajúcich oligomérov v roztoku sú príliš krátke (the longest typically being a 10-mer), ale keby ste text čítali trošku ďalej, tak sa by ste dozvedeli o úlohe minerálov pri spomínanej abiogénnej polymerizácii a o formovaní oligomérov až z 55 monomérov v prítomnosti vhodných minerálov, viď citát hore.

  51. Marek

    Inde, kdybych na to byl tázán, dal bych sice samozřejmě přednost rozumu, ale války o počátek všeho jinak nevedu.
    Mým důvodem ke vstupu do této diskuse skutečně je nonšalance, s jakou používáte jako argument věci skutečně nejednoduché. Pro objektivitu nutno říct, že tím samým, tedy zatím poznanými vlastnostmi specifických organických chemikálií, lze argumentovat pouze tehdy, pokud popisovaným dějům coby argumentům alespoň principiálně předkladatel rozumí jak v případě, že mají něco dokazovat, tak tehdy, kdy mají naopak to samé vyvracet. Ve vašem případě jsem ale skutečně takového dojmu nenabyl.
    Na to solení polévky jsem se vás ptal z velmi zásadního důvodu. Jedná se o jev velmi obvyklý a velmi banální, neboť vy-příležitostný hladovec si pokrm po svém zvyku jednoduše ochutíte. Víte však, co při rozpouštění soli probíhá? Byl byste ochoten osolit si pokrm i jiným chloridem, než sodným? Pokud ano, kterým? Znáte kinetiku rozpouštění, tzn. difuzi rozpouštěné látky do rozpouštědla? Tušíte něco o tom, jaký vliv na to má třeba povrchové napětí, a že při tom konkrétním ději také dochází ke spotřebě tepla? K čemu by tedy došlo, kdybyste té polévce další teplo dodával, nebo naopak odebíral? Empiricky jste se přesvědčil o tom, že když to zamícháte lžící, rozpouštění, tedy osolení, tím urychlíte. Pochopil jste ale, čím to vlastně je? A aby toho nebylo málo, jste si jedlíku vědom toho, že se vám při tom voda i sůl rozštěpila na ionty, neboli vám ta polévka disociovala? Budete strávníku po obdržení všech těchto informací, doplněných o číselné hodnoty, vůbec ochoten tu polévku zblajznout??
    Tak tedy, pouhé osolení polévky. A tolik se u toho stalo jak po stránce fyzikální, tak chemické. Přitom jsme se ani nedotkli toho, co by se stalo, pokud bychom polévku vystavili určitému záření, elektrickému proudu, změnili tlak v kuchyni, nebo s ní provedli mnoho dalších věcí, které se na tomto světě dějí.
    Skutečně jste si tedy bezpečně jist hydrolýzou některých polypeptidů jakožto argumentem? Víte, nemám potřebu vás tím celým dehonestovat, asi si představíte, že ta hydrolýza znamená štěpení látky působením vody. Ale dokážete, podobně, jako řekněme já tu polévku, popsat, co všechno fyzikálního a chemického bylo před hydrolýzou, co při ní, a co po ní tak, aby to celé skutečně byl potvrzující, nebo vyvracející argument? Vzhledem k tomu, že takto píšu, jsem samozřejmě chemik. Ale z naprosto totožného principu, na základě své laické znalosti trávícího ústrojí bych se opravdu nepustil ani s lékařem, ani s nelékařem do polemiky na téma příčiny Crohnovy nemoci.

  52. Petr TomekPetr Tomek

    ind: „Pozorujeme zvyšující informační složitost kódu DNA? Můžete uvést příklad“

    To samožřejmě vidíme, tedy přesněji pozorujeme vznik nových genů. Já ale nejsem genetik, abych vám na tohle dával přednášku.

  53. Jaroslav Štejfa

    K indovi, tentokrát již naposledy:
    1) Kód – podle Wikipedie (na čemž jsme se před časem zřejmě shodli) je způsob, jakým se informace sdělují nebo zapisují na různá média.
    Takže například kyselina sírová nějak „ví“, tedy má informaci, tedy je v ní kód, který říká, že setká-li se s mědí porodí v tomto společenství vodík a sůl. Rovněž setkají-li se dvě hmoty, nějak „vědí“, tedy je v nich kód, že jsou vzájemně přitahovány silou přímo úměrnou jejich hmotnosti a nepřímo úměrnou jejich vzdálenosti. Tak třeba samčí rostlinná buňka padne-li na správnou bliznu, dá vzniknout semenu (kódy a šifry si do toho namontujte sám – dokonce tam můžete vrazit už i ten zámek, který na blizně nebude otevřen nesprávným klíčem nevhodného pylu). Takto lze pokrýt vaším potřeštěným kódováním veškeré znalosti exaktních věd. A teď vy do toho vpadnete s nějakou inteligencí, kterou nejste schopen ani formulovat.
    2) Přes opakovanou žádost o předložení nějaké teorie o potřebnosti vaší chimérické inteligence, pouze dokola blábolíte o své víře či nevíře.
    3) Jděte k šípku.
    Jaroslav Štejfa

  54. Ateistický laik

    ind: Právě víceúrovňová struktura a opakující se vzory a jejich vzájemné vazby nám ukazují na inteligenci.
    Mě teda „román“ o čtyřech opakujících se písmenech moc inteligentní připadá. 🙂
    Nevím, proč se mnou někdo nesouhlasí v tom, že text literárního díla je schopna vytvořit POUZE inteligence?
    Kde, kdy, jak? Já jen, že motáte několik věcí do sebe.

    Je to velmi jednoduché – neexistuje neinteligentní hodnotící metoda, která dokáže zhodnotit kód pro selekci.
    To jako myslíte, že chemické vazby danách sloučenin to (zpravidla) kopírování nezvládnou?

  55. ind

    @Medea

    ale keby ste text čítali trošku ďalej, tak sa by ste dozvedeli o úlohe minerálov pri spomínanej abiogénnej polymerizácii a o formovaní oligomérov až z 55 monomérov v prítomnosti vhodných minerálov, viď citát hore.

    Takhle připravili delší polymery …
    Our experimental approach
    is simple. A mineral is incubated with an activated monomer until
    a family of short oligomers are formed. The solid is separated by
    centrifugation and the activated monomers are replaced. This
    process is repeated as often as necessary for the production of
    oligomers of length 40 or more. Finally, the solid is eluted with a
    solution of sodium pyrophosphate and the eluate is analysed.

    https://ntrs.nasa.gov/archive/nasa/casi.ntrs.nasa.gov/19980119839.pdf

    Takže se jedná o řízenou výrobu, ne o spontánní reakci. V žádném jezírku nemůže dojít k odstřeďění a nahrazení monomerů a opakování tohoto postupu tak dlouho, dokud nedosáhneme polymerů požadované délky.
    Srovnejte si tento postup s tím, co jste citovala z planetopia.cz.

  56. ind

    @Marek

    Samozřejmě, že při rozpouštění látky dochází ke spotřebě tepla, neboť je daným částicím uvolněným z rozpouštěné látky předávána kinetická energie částic roztoku. Samozřejmě, že míchání polévky podpoří rozpouštění soli, neboť mícháním se sníží míra lokální nasycenosti roztoku v okolí dosud nerozpuštěné látky (navíc se nerozpuštěná sůl uvede do pohybu).
    Děkuji za připomenutí, chemie byla součástí mého inženýrského studia.

    Teď k té hydrolýze…
    Přijde mi, že když lidé opustí Boha, začnou uctívat nějakou náhražku.
    Tady je uctívána věda.

    Jsem přesvědčen, že mé znalosti dostačují k tomu, abych zpochybnil možnost tvorby delších polymerů v nějakém prehistorickém jezírku.
    Pokud by se delší polymery tvořily snadno, proč by vědci aplikovali opakovaný postup s odstřeďováním a nahrazováním těch kratších?

    This process is repeated as often as necessary for the production of
    oligomers of length 40 or more.

    https://ntrs.nasa.gov/archive/nasa/casi.ntrs.nasa.gov/19980119839.pdf

    Skutečně jste si tedy bezpečně jist hydrolýzou některých polypeptidů jakožto argumentem?

    Samozřejmě, že ano. Dokázal jsem, že citovaná argumentace z planetopia.cz o pravděpodobnosti vzniku polypeptidu délky 32 aminokyselin v prehistorickém jezírku je nesmyslná.
    A o to mi hlavně šlo.

  57. Lemmy

    Ind: Přijde mi, že když lidé opustí Boha, začnou uctívat nějakou náhražku.
    Tady je uctívána věda.

    Znie to dobre. Inými slovami, keď ľudia opustia rozprávky, tak začnú používať rozum. Ale pozor! Myslieť neznamená uctievať rozum. 😀

  58. ind

    @Medea

    To samožřejmě vidíme, tedy přesněji pozorujeme vznik nových genů. Já ale nejsem genetik, abych vám na tohle dával přednášku.

    Vznik nových genů automaticky neznamená rostoucí informační složitost.
    Naopak předpokládaně dochází k poškození funkčního kódu pomocí mutací, kódu, který se zrovna příliš nevyužívá, neboť je epigeneticky potlačen.
    Z hlediska informační vědy můžeme hovořit o rostoucím množství predispozic k nemocem v genomu člověka z důvodu poklesu množství informace a nárůstu informační entropie.

  59. ind

    @Jaroslav Štejfa

    Takže například kyselina sírová nějak „ví“, tedy má informaci, tedy je v ní kód, který říká, že setká-li se s mědí porodí v tomto společenství vodík a sůl.

    množství informace je dáno rozdílem mezi stavem neurčitosti systému (entropie), kterou měl systém před přijetím informace a stavem neurčitosti, která se přijetím informace odstranila
    https://aleph.nkp.cz/F/?func=direct&doc_number=000000456&local_base=KTD

    Takto lze pokrýt vaším potřeštěným kódováním veškeré znalosti exaktních věd.
    Ano, veškerá znalost obsahuje informaci, a informaci je možno zapsat pomocí kódu.
    Každé slovo, které jste napsal do diskuze, je kódem, který zaznamenává informaci.

    Kdyby zde v diskuzi začal produkovat písmena generátor náhodných písmen, pak by daná písmena nenesla informaci (optimální generátor by produkoval posloupnost písmen s nejvyšší možnou entropií a tudíž by informační hodnota posloupnosti písmen byla nulová).

    Proč vás kód tolik irituje?
    Není to proto, že kód je tvořen inteligencí?

    Vysvětleme si, co myslím hlubší strukturou, na příkladu. Když vyberu náhodné slovo z knihy, a řeknu vám, abyste ho uhádli, nebudete mít ani ponětí, jaké to může být slovo. Budete muset prostě hádat. Když ale místo toho vyberu náhodné slovo z knihy a řeknu vám, abyste hádali slovo, které bude následovat, budete sice stále tipovat, ale bude to o něco snažší uhádnout. Když vám přečtu dvě po sobě jdoucí slova z knihy, a řeknu vám, ať hádáte třetí následující slovo, bude to ještě lépe odhadnutelné. Když budete znát tři slova, bude to ještě snažší… Schopnost uhádnout bude snadná. Výsledkem struktury jazyka je, že svoboda volby slov klesá s delšími řetězci slov. Proto můžeme instinktivně doplňovat věty toho druhého. Aby to mohli kvantifikovat, Doyle a McCowanová si vypůjčili měření entropie od Clauda Shannona. Entropie je vyjádření nahodilosti. Představme si ji jako množství Ano-Ne otázek, nebo bitů informací, které potřebujeme k uhádnutí dalšího slova. Jak se předpověditelnost zvyšuje, informační entropie se snižuje. Doyle a McCowanová vypočítali entropii pro jednotlivé hloubky, či řády, kdy jednotlivá slova jsou první řád, skupina dvou slov druhý řád, skupinka tří slov třetí řád… Poté vynesli do grafu závislost informační entropie na této hloubce. Pro dospělé jedince, jak jsme čekali, zjistili, že se informační entropie snižuje se zvyšující se hloubkou. Toto je výsledkem struktury v našich komunikačních systémech. Překvapivě ty samé výsledky byly získány i pro jazyk delfínů, zjistili ten samý vzorec. Komunikační systém delfínů zobrazuje snižující se informační entropii v závislosti na délce sekvence zvukových signálů. To znamená, že delfíní komunikační systém má jistá pravidla, a možná tak jsou delfíni taky schopni dokončovat věty druhých. (delfíní zvuky) Porovnejte to s náhodnou sekvencí znaků, které mají vodorovnou křivku v grafu informační entropie, jelikož tu není žádná závislost mezi těmito znaky. Protože je tento vzorec stejný pro lidské a jíné než lidské komunikační systémy, Doyle a McCowanová navrhli, že snižující se entropie je nezbytná pro předávání toho, čemu říkáme znalosti a vědění.
    https://cs.khanacademy.org/computing/computer-science/informationtheory/moderninfotheory/v/seti
    zdůraznění vlastní

    Pořád odmítáte pravdu o tom, že informační složitost koresponduje s inteligencí?

  60. ind

    @Lemmy

    Inými slovami, keď ľudia opustia rozprávky, tak začnú používať rozum.

    „Rozprávku“ o jezírku s náklaďáky aminokyselin ještě mnozí neopustili, nebo se stydí k tomu přiznat.

  61. Marek

    Je to Inde trochu jinak. Je měřitelné, že rozpuštěním špetky soli (NaCl) v běžné porci polévky ji sice trochu ochladíte, ale opravdu málo. Jen na okraj, aby se znatelně ochladila, muselo by té kuchyňské soli být opravdu mnoho, několik desítek gramů. Sice to nesouvisí s termodynamikou, ale nebylo by to pochopitelně pak k jídlu :). Je to však způsobeno nikoliv pouze předáváním kinetické energie roztoku částicím. Nejprve musí být rozbita krystalová mřížka Nacl, k čemuž je kinetická energie rozpouštědla spotřebovávána. Poté je však uvolněna při hydrataci iontů (to je po rozbití mřížky další podstatná etapa rozpouštěcího děje) tzv. hydratační energie, která deficit energie v tomto případě nahradí pouze neúplně. Celková bilance je tedy negativní, tepla rozpouštěním NaCl v systému (polévce) ubude. V případě rozpouštění jiných solí ovšem tepelné bilance mohou být i kladné, protože uvolněná hydratační energie je větší, než spotřebovaná k rozbití mřížky. Může ovšem taky dojít při rozpouštění zase dalších solí ve vodě k bilanci velmi negativní, kde je tepla rozbíjením odebráno skutečně mnoho, a hydratační energie jej nevynahradí. Viz. známé chladící pytlíky na třeba nakopnutý kotník. V jedné větě – při rozpouštění látek krystalických (amorfní nechme nyní stranou) je tepelná bilance dána rozdílem mezi energií, spotřebovanou pro rozbití mřížky, a uvolněnou energií hydratační.
    Vůbec jsem neměl v úmyslu vás nachytat. Tento příklad jsem naopak použil proto, že solení polévky je v chemii záležitost až klišovitá, některým chemikům – dobrodruhům (povětšinou studentům) je také inspirací k dosti praštěným experimentům. Mou důvěru k vašemu chápaní podstaty fyzikálně-chemických dějů při samotném průběhu chemických interakcí jak řízených, tak spontánních, jste však neposílil. Nezbývá mi, než trvat na tom, že je nevyhnutelné vlastním argumentům rozumět.
    Mimochodem, výzkumu oligo a polypeptidů, stejně tak genetickému ani nevím, jak dlouho budu fandit. Bude-li laboratorně stvořen život, sice to jednou provždy odsune Knihu knih do bájí, ale představa, že by mi jednou měl kontrolovat řidičák robocop, není zrovna lákavá. Sci-fi s podobnými tématy je dostatek, a lidstvo je v tomto ohledu navíc jeden velký blbec, který kontroluje jen dotud, dokud kontrolovat lze.

  62. ind

    @Marek

    Je to Inde trochu jinak.

    Ne, není to trochu jinak. Vyjádřil jsem se správně, i když ne úplně. Předáváním kinetické energie částicím rozpouštěné látky dochází ke spotřebě tepla.

    Proti vaší snaze o manipulaci se důrazně ohrazuji. Tím, že mé sdělení rozšíříte nebo doplníte, ho nepopřete.

    Je to však způsobeno nikoliv pouze předáváním kinetické energie roztoku částicím. Nejprve musí být rozbita krystalová mřížka Nacl, k čemuž je kinetická energie rozpouštědla spotřebovávána.
    Probíhá rozbití krystalové mřížky NaCl jinak, než předáváním kinetické energie částic rozpouštědla částicím rozpouštěné látky?

  63. Ateistický laik

    ind: Pořád odmítáte pravdu o tom, že informační složitost koresponduje s inteligencí?
    Kde vidíte inteligenci v chemickém kopírovacím automatu?

    Naopak ta vaše hypotetická inteligence je pěkně svinská, ža si vymyslela spoustu bakterií a virů způsobující nemoce. Co je na tom prosímvás inteligentního?

  64. Medea

    Our experimental approach is simple. A mineral is incubated with an activated monomer until a family of short oligomers are formed. The solid is separated by centrifugation and the activated monomers are replaced. This process is repeated as often as necessary for the production of oligomers of length 40 or more. Finally, the solid is eluted with a solution of sodium pyrophosphate and the eluate is analysed.

    „Takže se jedná o řízenou výrobu, ne o spontánní reakci. V žádném jezírku nemůže dojít k odstřeďění a nahrazení monomerů a opakování tohoto postupu tak dlouho, dokud nedosáhneme polymerů požadované délky.“

    Ind, nerozumiete tomu pokusu. Pokus prebiehal v malej uzavretej aparatúre, nie v jazierku, tak sa museli umelo postarať o to, k čomu v jazierku dochádza prirodzene. Polyméry sú prirodzene adsorbované jazernými ílmi a monoméry sú nahradzované pohybom vôd v jazierku. (Na konci pokusu sa urobila elúcia pyrofosforečnanom sodným a eluát sa podrobil analýze.)

  65. Medea

    „Nevím, proč se mnou někdo nesouhlasí v tom, že text literárního díla je schopna vytvořit POUZE inteligence?“

    Text literárneho diela môže byť vygenerovaný aj jednoduchým stochastickým procesom, pokiaľ je k dispozícii dostatočne mnoho nezávislých náhodných pokusov. Pokiaľ je tých pokusov nekonečne mnoho, tak ten text môže byť s pravdepodobnosťou 1 vygenerovaný aj nekonečne mnohokrát.

    Ale vznik a vývoj organizmov je usmerňovaný prirodzeným výberom.

    „Základní otázka zní – je k tvorbě kódu nutná inteligence?
    Tvrdím, že ano a jsem schopen to i doložit.“

    Nie, nie ste. Pokiaľ je k dispozícii veľmi veľa nezávislých náhodných pokusov, tak nepotrebujete ani ten prirodzený výber

    „Je to velmi jednoduché – neexistuje neinteligentní hodnotící metoda, která dokáže zhodnotit kód pro selekci.“

    Prírodné prostredie filtruje „kódy“ (gény). Ak má organizmus príliš nevhodný „kód“, tak mu ho prostredie znemožní odovzdať. „Kódy“, ktoré sa lepšie šíria ako ich alternatívy, sú zase protredím uprednostnené pred horšie sa šíriacimi alternatívami.

    „Pokud spoléháte na extrémně malou pravděpodobnost,
    věřte si klidně v to, že nastal jev, který měl pravděpodobnost 0,0000000000000000000000000000001%.
    Já zůstavám v přesvědčení, že nastal jev, který měl pravděpodobnost 99,9999999999999999999999999999999%.“

    Len sa Vám nepodarila taká „maličkosť“, ukázať, že živé organizmy vznikli na Zemi s 99,9999999999999999999999999999999% pravdepodobnosťou vďaka zásahu inteligencie 🙂
    Dokonca aj teista môže veriť, že Boh stvoril svet umožňujúci samovoľný vznik komplexných organizmov, teda ani „mávanie“ Bohom tú pravdepodobnosť nezvyšuje 🙂

  66. Medea

    „věřte si klidně v to, že nastal jev, který měl pravděpodobnost 0,0000000000000000000000000000001%“

    Ind, hoďte sto krát za sebou vyváženou kockou, a vygenerujete jav, ktorého pravdepodobnosť je 1.53… × 10^-78 🙂

    (Pomocou stonásobného hodu generujete reťazec čísel z {1, …, 6} s dĺžkou 100, takýchto reťazcov je 6^100, každý generovateľný s rovnakou pravdepodobnosťou.)

  67. Medea

    Tým nechcem povedať, že samovoľný vznik života na Zemi má takúto pravdepodobnosť, len ukázať, že extrémne nepravdepodobné javy sú úplne bežné. Keď je istý jav zjednotením javov extrémne nepravdepodobných, tak pri každom vykonaní náhodného pokusu nastane jav extrémne nepravdepodobný.

  68. Marek

    Chemie ani fyzika nejsou Inde nazývány obory exaktními bezdůvodně. Proto uděláme rekapitulaci.
    Původní otázka zněla, zda víte, co termodynamického se děje při solení polévky, doplněna pak, zda víte, že se u toho spotřebovává teplo.
    Odpověděl jste, že to víte, „neboť je daným částicím uvolněným z rozpouštěné látky předávána kinetická energie částic roztoku.“
    Tak tedy
    – Nejprve, aby bylo jasno v pojmech, částicemi jsou v tomto případě ionty soli a vody
    – Energie především není předávána částicím uvolněným, ale těm ve mřížce, aby se mohly uvolnit.
    – Předávaná energie nepatří částicím roztoku, ale rozpouštědla, kterým je voda. Roztokem se voda se solí stane teprve poté, kdy začnou být uvolňovány částice z krystalové mřížky NaCl. Pro rozbití mřížky byla spotřebována kinetická energie rozpouštědla, došlo tedy k poklesu energie v systému, což vedlo k jeho ochlazení.
    – Částicím, uvolněným z mřížky není předávána kinetická energie, naopak, poté, kdy jsou uvolněné částice hydratovány, tzv. obaleny ionty (částicemi) rozpouštědla, dochází k uvolnění hydratační energie do systému. Souběžně se spotřebováváním jedné energie pro rozbíjení je tedy tato energie do systému naopak dodávána, čímž je působeno proti ochlazování.
    – Vzhledem k tomu, že konkrétně u rozpouštění NaCl ve vodě je množství energie, potřebné pro rozbití vyšší, než je množství uvolněné hydratační energie, v absolutním vyjádření se energie v systému spotřebovala, což je správným vysvětlením energetické bilance, tedy toho, proč se zmenšilo množství energie v systému.
    – Samotná spotřeba při rozbití mřížky je jev pouze parciální. V předchozím komentáři bylo cosi o nakopnutém kotníku, na což se tady dá navázat tím, že zápas nevyhraje mužstvo, které vstřelí gól (jev parciální), ale to, které vstřelí víc gólů, než soupeř. Jde tedy o identickou situaci, kdy kinetici dali hydratantům taky víc gólů.

    Z uvedeného plyne, že jednak používáte chybné výrazy, následně chybně vysvětlujete pokles energie systému pouze tím, že byla spotřebována rozbíjením mřížky. Tento pokles energie systému a následné jeho ochlazení je však způsobeno ne tím, že bylo pouze spotřebováno příslušné množství kinetická energie, ale tím, že množství vzniklé energie hydratační je nižší, než to spotřebované. Jde o rozdíl energie spotřebované a vzniklé.
    To je celá podstata. Sice žijeme v divné době naprosto matoucího používání výrazů, majících svůj neměnný jiný význam. Také, kdy jsou těmito výrazy chybně popisovány beztak jinak proběhnuvší události, nebo je z nich prezentována jen zavádějící polovina. Ve výše uvedených oborech to však nelze, což právě je důvod, proč jsou nazývány exaktními. Nedá se Inde nic dělat, mou pochybnost jste tímto přeměnil na jistotu. Nepouštějte se tedy do věcí složitých, neboť „pohříchu“ opakovaně nerozumíte ani těm jednodušším.

  69. Petr TomekPetr Tomek

    ind: „Vznik nových genů automaticky neznamená rostoucí informační složitost.“

    WTF a co tedy bude znamenat rostoucí informační složitost, když ne vznik nové informace a její začlenění do stávajícího kódu? To jste si jako přivlastnl právo rozhodovat o tom, co to informační složitost je?

  70. Jaroslav Štejfa

    Všem, kteří odporují indovi:
    Je dobré stále zdůrazňovat fakt, že ind záplavou pseudovědeckých námitek proti evoluci zakrývá vlastní prázdnotu zobrazenou tvrzením, že ke vzniku života a jeho fungování je třeba nějaká inteligence, kterou nedovede nijak dál specifikovat; tedy zakrývá plíživý regres – jaká inteligence stvořila inteligenci indovu atd.

  71. toli

    jaká inteligence stvořila inteligenci indovu atd.

    To je humorné,že by jakási inteligence stvořila inteligenci Indovu,ještě že nemám s Indovým OTCEM nic společného 🙂 🙂

  72. Jaroslav Štejfa

    K indovi:
    Cituji:
    množství informace je dáno rozdílem mezi stavem neurčitosti systému (entropie), kterou měl systém před přijetím informace a stavem neurčitosti, která se přijetím informace odstranila
    https://aleph.nkp.cz/F/?func=direct&doc_number=000000456&local_base=KTD
    Ano, veškerá znalost obsahuje informaci, a informaci je možno zapsat pomocí kódu.
    Každé slovo, které jste napsal do diskuze, je kódem, který zaznamenává informaci.
    Kdyby zde v diskuzi začal produkovat písmena generátor náhodných písmen, pak by daná písmena nenesla informaci (optimální generátor by produkoval posloupnost písmen s nejvyšší možnou entropií a tudíž by informační hodnota posloupnosti písmen byla nulová). . . . .

    Fajn – vyjděme z toho. Předložená definice je dobrá za dvou podmínek. Jednak připouští, že různé obory lidského vědění ji modifikují pro své účely a nelze je jednoduše zaměňovat. Nejdůležitější však je, že definice předpokládá vznik informace a manipulaci s ní u inteligentního systému – v námi známém světě tedy u lidí. Z toho plyne hloupost nebo zlovůle zaměňovat pojmy nebo předpokládat u systému, který není sám schopen života a nevyznačuje se inteligencí, že nějak manipuluje nebo ovládá nějakou informaci. Prostě kyselina solná na základě jakýchsi fyzikálně chemických vlastností interaguje s mědí a kyselina ribonukleová na jakýchsi fyzikálně chemických vlastností interaguje nějak jinak s něčím jiným (ano, daleko složitěji). Ale jak se při těchto reakcích pohybují informace a jejich entropie, je abstraktní konstrukce lidského intelektu – který to přibližně dokáže popsat a nějak smysluplně využít. Ano, popis takových jevů, ať už vědecký nebo náboženský vyžaduje inteligenci. ¨
    Jaroslav Štejfa

  73. ind

    @Marek

    Nepouštějte se tedy do věcí složitých, neboť „pohříchu“ opakovaně nerozumíte ani těm jednodušším.

    To bych mohl říct já o vás. Snažíte se mi namluvit, že polévka není roztok, ale pouhá voda. 😀

    Předávaná energie nepatří částicím roztoku, ale rozpouštědla, kterým je voda. Roztokem se voda se solí stane teprve poté, kdy začnou být uvolňovány částice z krystalové mřížky NaCl.

    Vaše použití slova pouze ve vyjádřeních, která nejsou konzistentní:

    Cit 1.: Je to však způsobeno nikoliv pouze předáváním kinetické energie roztoku částicím. Nejprve musí být rozbita krystalová mřížka Nacl, k čemuž je kinetická energie rozpouštědla spotřebovávána.

    Cit 2.: Z uvedeného plyne, že jednak používáte chybné výrazy, následně chybně vysvětlujete pokles energie systému pouze tím, že byla spotřebována rozbíjením mřížky.

    Vidíte, při vašem požadavku na exaktnost, jste v této věci zcela selhal.

    Podívejte se na tato vaše vyjádření, sám používáte něco, co mi pak vyvracíte… 🙂
    1. Je to však způsobeno nikoliv pouze předáváním kinetické energie roztoku částicím.
    2. Předávaná energie nepatří částicím roztoku, ale rozpouštědla, kterým je voda.

    A našel bych takových věcí více. Obvykle tyto analýzy příspěvků nedělám, ale tímto vám chci pouze nastavit zrcadlo. Nejdříve si zameťte před vlastním prahem, než někomu něco budete příště vytýkat. 🙂

  74. ind

    @Medea

    Tým nechcem povedať, že samovoľný vznik života na Zemi má takúto pravdepodobnosť, len ukázať, že extrémne nepravdepodobné javy sú úplne bežné.

    Medeo, jak můžete udělat takovou logickou chybu? Když si 100x hodím kostkou, dostanu posloupnost 100 čísel 1 až 6 se 100% pravděpodobností, tedy s jistotou.

    Běžný jev je posloupnost 100 čísel, extrémně nepravděpodobný jev – daná posloupnost, kterou jsem dostal při hodu 100x kostkou, – není vůbec běžný. S obrovskou pravděpodobností jej už člověk nikdy nezopakuje.

    Spojujete pravděpodobnosti dvou odlišných oblastí.
    O běžný jev by se jednalo, kdybyste si zvolila posloupnost 100 čísel 1-6 a on by s velkou pravděpodobností nastal.

    Vztáhněte si to na pravděpodobnost vzniku života.

  75. ind

    @Medea

    „Jsem přesvědčen, že mé znalosti dostačují k tomu, abych zpochybnil možnost tvorby delších polymerů v nějakém prehistorickém jezírku.“
    Viď Dunning–Kruger effect: https://en.wikipedia.org/wiki/Dunning_Kruger_effect

    K zpochybnění stačí ukázat na nějakou mezeru v poznání.
    Např. nebyl proveden experiment s jezírkem … 🙂

    Kdybyste měla pravdu ohledně požadovaných znalostí ke zpochybnění, pak jak byste mohl zpochybňovat vzkříšení Ježíše Krista z mrtvých? 🙂

  76. ind

    @Petr Tomek

    WTF a co tedy bude znamenat rostoucí informační složitost, když ne vznik nové informace a její začlenění do stávajícího kódu?

    Samozřejmě vznik nové informace znamená rostoucí informační složitost. Co však řeknete na škodlivé mutace v kódu, který je zrovna epigeneticky potlačen a který se nevyužívá? Selekce na něj nemůže. Dochází k poškozování a ničení informace. Co má větší pravděpodobnost, aby nastávalo?

    Organismy postupem času ztrácejí epigenetickou přizpůsobivost a může jim hrozit z toho důvodu i vyhynutí.

    Evoluční schopnost přežít nemá nutně souvislost s informační složitostí genomu.

  77. ind

    @Jaroslav Štejfa

    Je dobré stále zdůrazňovat fakt, že ind záplavou pseudovědeckých námitek proti evoluci zakrývá vlastní prázdnotu zobrazenou tvrzením, že ke vzniku života a jeho fungování je třeba nějaká inteligence, kterou nedovede nijak dál specifikovat

    Nemám evoluční teorii za „svatou krávu“ a mám svobodu o ni kriticky smýšlet. Přijímám vše, co je experimentálně ověřitelné. Pseudovědecké jsou vaše názory.

    definice předpokládá vznik informace a manipulaci s ní u inteligentního systému – v námi známém světě tedy u lidí

    Popíráte existenci umělé inteligence? 🙂

  78. Petr TomekPetr Tomek

    ind: „Samozřejmě vznik nové informace znamená rostoucí informační složitost. Co však řeknete na škodlivé mutace v kódu, který je zrovna epigeneticky potlačen a který se nevyužívá? Selekce na něj nemůže. “

    Co bych na ně říkal? I kdyby ze všech mutací bylo těch prospěšných setna promile, tak to nakonec budou ty úspěšné, protože se předají dál. Neaktivní škodlivé mutace neškodí, ale ve vhodném prostředí se projeví a znovu vyselektují. Tím se nemění vůbec nic podstatného.

    „Evoluční schopnost přežít nemá nutně souvislost s informační složitostí genomu.“

    No bingo! To je tedy objev. To jste si ovšem tvrdil sám. Tak teď jste si to sám vyvrátil.

  79. ind

    @Petr Tomek

    Neaktivní škodlivé mutace neškodí, ale ve vhodném prostředí se projeví a znovu vyselektují.
    Dobře, ale po selekci zůstanou i ti, kteří mají v jiných nepoužívaných oblastech více škodlivých mutací, než právě ti, co byli odstranění selekcí.

    Stačí si na to udělat simulaci a je jasné, že ve výsledku dochází k poškození informace. Co říkáte na zákon o růstu informační entropie?

    A víte, kolik je geneticky podmíněných nemocí, které se mohou nebo ani nemusí v životě jedince projevit?

    Jinak – nic, co jsem tvrdil, jsem si nevyvrátil. Asi zase něco špatně chápete.

  80. Marek

    Ach jo…
    Skutečně si na vás Inde nepotřebuji nějak brousit znalosti a logiku.
    Víte, měli jsme na katedře fyziky jednoho vláčkaře. Volné chvilky trávil na nádraží, kde se kochal sledováním posunování vagonů. Znal všechny mašinky, parametry, vagony, rozchody kolejnic, pražce, směsi náspů. Prostě všechno, co se týká železnice. Studentům dával příklady pro výpočet síly, ve kterých soupravu táhla lokomotiva na obrovský setrvačník s pružinou. Toho byste svými námitkami dokonale zničil…

    Vlaky na setrvačník přirozeně neexistují, stejně tak polévka je jak roztokem, tak také směsí již před jejím osolením. Kdybych místo polévky uvedl pouhou vodu, mohl byste trvat na tom, že pokud by nebylo zmíněno, že jde o vodu destilovanou, půjde také o roztok. Tudy se ale postupovat skutečně nedá, protože bychom opravdu skončili u nekonečného podrobného popisování podmínek, které rozpouštění ovlivňují, z toho některé v pikohodnotách. Zadavatelé takových úloh jaksi a priori předpokládají, že jejich řešitelé se nebudou zabývat exaktností takových okolností, ale exaktností samotných dějů, v našem případě rozpouštěním NaCl ve vodě, a termodynamikou tohoto děje. Ti pohotovější řešitelé pak z kontextu snadno pochopí, že tento příklad reprezentuje rozpouštění pevných látek v kapalinách, mající svůj exaktně popsatelný průběh. Je-li náležitě vědomostně vybaven, zpaměti si uvědomí, že je zde spotřebováno teplo. Zároveň, že např. rozpouštěla-li by se jiná sůl, naopak by se více tepla uvolnilo, než spotřebovalo, a vzniklý roztok by se jím zahřál. Ví to proto, že zná termodynamické děje při průběhu rozpouštění, a ví, jak stanovit celkovou tepelnou bilanci. Ví, že k výsledku kladnému nebo zápornému dojde tím, že od energie spotřebované odečte energii uvolněnou. Jak zmíněno, ví, že při rozpouštění jedné chemikálie je výsledek kladný, při rozpouštění jiné je zase záporný. To jej dále vede k tomu, že začne uvažovat, co se stane, ovlivní-li tu bilanci. Třeba změnou podmínek, za kterých rozpouštění probíhá. Potom začne ovlivňovat jiné děje, za použití jiných sloučenin. Nebo ale taky nemusí, protože už to udělal někdo před ním. Pak stačí znát výsledky předchozích experimentů, systematizovat je a aplikovat. Atd. atd. Takto u něj vznikne penzum znalostí, které dále používá. Je to nekončící cesta, pokud se na ní orientujeme pomocí dopravních značek – vědomostí, dovedou nás i k jezírkům.

    Třikrát je zde už zbytečně moc, ale budiž
    Chce-li někdo argumentovat, nezbytně, naprosto nezbytně svým argumentům musí rozumět. Lhostejno, zda u témat jednoduchých, či složitých. Musí znát význam používaných pojmů a podstatu dějů, které těmi pojmy popisuje.
    Chcete-li vy odborně posuzovat ta „jezírka“ z fyzikálního a chemického pohledu, musíte jak vy, tak kdokoliv jiný, kdo by chtěl činit totéž, k tomu být vybaven. Alespoň principiálně tomu, co se tam odehrává, rozumět. Zdali rozumíte chemii polypeptidů, k tomu jsme se ani nedostali, protože jste ztroskotal již na prostém rozpouštění.

    A k tomu zvýrazněnému „pouze“. Tam je pudlo jádra, pudlo pudla, jádro pudla a také jádro jádra.. Bible je plná přirovnání, proto se jí inspirujme. Už se tak vlastně stalo tím fotbalem. Tak tedy Zeptám-li se vás, zda víte, že Francie vyhrála nad Chorvatskem, a vy odpovíte, že ano, a že je to proto, že jim dali čtyři góly, vítězství Francie jste tím nezdůvodnil. Jejich vítězství byste zdůvodnil tím, že dali Chorvatsku čtyři góly, kdežto Chorvatsko jim pouze dva. Že vyhráli 4:2.
    Ještě mě napadá, že jste tam náznak zdůvodnění měl. Popisoval jste, jak je kinetická energie předávána uvolněným iontům. Vzhledem k tomu, že ta energie je ale předávána ne iontům uvolněným, ale těm zamřížovaným, aby se mohly uvolnit, mohli bychom to taky převést do fotbalové řeči. Bylo by to, jako byste vítězství Francouzů zdůvodnil tím, že si dali pár vlastňáků. A když k tomu ještě přidáme ten zmatek v pojmech, ještě byste dodal, že si ty vlastňáky dali basketbalovým míčem..

  81. Jaroslav Štejfa

    K indovi:
    Zase váš typický únik od podstaty k okrajovým záležitostem. Nicméně umělá inteligence je právě (odvolávám se na sebe sama) dílem „manipulace nebo ovládání nějakých informací“ člověkem, neexistuje sama od sebe. A má svá omezení daná autorem – jak ve složitosti, tak v rozsahu vědomostí autora, tak neschopností dokonale simulovat psychické procesy autora.
    Zase pokračujete v blábolech a překrýváte neschopnost postavit věrohodný model inteligence, která stvořila RNA a zároveň se vyhnout nekonečnému regresu. Jinak řečeno – jestliže někdo kritizuje druhého za chabou schopnost přeplavat Labe a pak se provalí, že neumí ani plavat, je směšný.
    Jaroslav Štejfa

  82. Medea

    Tým nechcem povedať, že samovoľný vznik života na Zemi má takúto pravdepodobnosť, len ukázať, že extrémne nepravdepodobné javy sú úplne bežné.

    „Medeo, jak můžete udělat takovou logickou chybu? Když si 100x hodím kostkou, dostanu posloupnost 100 čísel 1 až 6 se 100% pravděpodobností, tedy s jistotou.
    Běžný jev je posloupnost 100 čísel, extrémně nepravděpodobný jev – daná posloupnost, kterou jsem dostal při hodu 100x kostkou, – není vůbec běžný. S obrovskou pravděpodobností jej už člověk nikdy nezopakuje.“

    Žiadnu logickú chybu som neurobila. Hovorím o tom, že výskyt extrémne nepravdepodobných javov je úplne bežný. Hodíte 100 krát vyváženou kockou a takýto jav nastane (a príroda neprestajne vrhá kvantové „kocky“). Nehovorím o tom, že keď hodíte druhý raz, tak s veľkou pravdepodobnosťou ten istý elementárny jav nastane, ale vždy keď hodíte, tak nejaký extrémne nepravdepodobný jav nutne nastane 🙂

    „Spojujete pravděpodobnosti dvou odlišných oblastí.“

    Dvoch? Ja som hovorila len o pravdepodobnosti elementárnych javov v prípade stonásobného hádzania kockov.

  83. ind

    @Marek

    Chce-li někdo argumentovat, nezbytně, naprosto nezbytně svým argumentům musí rozumět. Lhostejno, zda u témat jednoduchých, či složitých. Musí znát význam používaných pojmů a podstatu dějů, které těmi pojmy popisuje.

    A protože sám pojmům skvěle rozumíte, vyjadřujete se o teple jako o stavové veličině. 😀
    … tepla rozpouštěním NaCl v systému (polévce) ubude

    Navíc máte problém s logikou…
    Napsal jsem:
    při rozpouštění látky dochází ke spotřebě tepla, neboť je daným částicím uvolněným z rozpouštěné látky předávána kinetická energie částic roztoku

    Vaše reakce:
    1. Částicím, uvolněným z mřížky není předávána kinetická energie
    2. Předávaná energie nepatří částicím roztoku, ale rozpouštědla, kterým je voda.

    To budí dojem předpokladu, že částice rozpuštěné látky jsou podle vás „v jiné dimenzi“ (popř. naprosté izolaci), neboť jim není ani předávána kinetická energie, ani ji nepředávají.

    Vidíte, že téměř vždy se dá něco najít. 🙂 A to máte být vysokoškolský učitel. 😉

  84. Medea

    Kreacionisti často hovoria o tom, že javy s extrémne malou pravdepodobnosťou sú nemožné, ale oni nastávajú bežne – viď môj príklad s kockou (a stačí si napr. uvedomiť neprestajné vrhanie kvantových „kociek“ v prírode).

  85. ind

    @Jaroslav Štejfa

    A má svá omezení daná autorem – jak ve složitosti, tak v rozsahu vědomostí autora, tak neschopností dokonale simulovat psychické procesy autora.

    S tím rozsahem vědomostí nemáte pravdu.

    Podívejte se na toto…
    Firma Debatera prezentovala opět v ostré zkoušce, kdy s počítačem diskutovali dva profesionální debatéři na náhodné téma, na které se ani jedna strana nemohla dopředu připravit. Jedním z nich byla otázka, zdali mají vlády financovat vesmírný průzkum.
    Zatímco lidský debatér veřejné financování vesmíru odmítl, stroj za něj bojoval s tím, že posune lidstvo dál, přinese ekonomický přínos, a proto se vyplatí. Ti, kteří se experimentu účastnili v pozici diváků, třeba Dieter Bohn z The Verge, přitom později přiznali, že celý experiment působil trošku strašidelně.

    V tomto případě přítomní slyšeli syntetizovaný ženský hlas, který se namísto strohých odpovědí anebo striktních tahů po herní ploše snažil v přirozeném jazyce vyvrátit argumenty lidského mluvčího. Do hry přitom mohly vstupovat i nejrůznější argumentační strategie, přetvářka, manipulace a tak dále.

    https://www.zive.cz/clanky/ibm-debater-konecne-poradny-souboj-cloveka-a-stroje-tento-vas-rozdrti-slovem/sc-3-a-193728/default.aspx

  86. Ateistický laik

    ind: S tím rozsahem vědomostí nemáte pravdu.
    Ale má, dočtěte si ten článek do konce cituji: „I proto působí IBM Debater jako hotové zjevení, i když i on má své limity a zatím umí diskutovat jen o omezeném výčtu témat. “
    Tomun neříkám (umělá) inteligence, ale program se schopností odpovídat na dané otázky, na základě opravdu ale opravdu velkého množství dat. Program je schopný ty data analyzovat. Ano, je to výborné, pro další vědecké práce a zpracování mnoha údajů se to hodí (to člověk ať je jakýkoliv génius prostě nezvládne, protže si to není schopen ani přečíst), ale říkat tomu inteligence?
    Opravdu by mě zajímalo, co by řekl na bibli. 🙂

  87. Jaroslav Štejfa

    K indovi:
    Podíval jsem se . Mimochodem, stroj se místy skutečně nechytal, ale jak napsali ti, kteří byli svědky celé show, nejstrašidelnější bylo právě to, že nevěděli, zdali to není jen součástí jeho hry. Ale toto je dnes opravdu vrchol veřejně dostupné technologie. I proto působí IBM Debater jako hotové zjevení, i když i on má své limity a zatím umí diskutovat jen o omezeném výčtu témat. Jinak řečeno, je to dílo člověka a jeho kvalita je zcela závislá na lidských schopnostech mu informace nadělit v nějakém kódu. Jako třeba když spisovatel napíše knihu. Aby stroj dokázal porozumět argumentaci protivníka, musí pochopit nejen význam jednotlivých slov, ale celého textu a především kontext. Zatím je to nepřekonatelný problém.
    Ale zase jsme odbočili od toho hlavního. Stále se vyznačujete neschopností postavit věrohodný model inteligence, která stvořila RNA a zároveň se vyhnout nekonečnému regresu.
    Jaroslav Štejfa

  88. Jaroslav Štejfa

    Než jsem se rozkoukal, Ateistický laik pregnantněji vyjádřil to samé. To s tou Biblí je excelentní.
    Jaroslav Štejfa

  89. Marek

    Udivuje mne Inde, kde berete energii se s tolika lidmi vyloženě handrkovat. Má spekulace – pokud u svého boha, potom je ten lepší, než lithium-sírová baterie. Pro mne je komunikace s vámi duševně vysilující, tak, jako všechny ostatní, jsou-li podobně bezvýsledné.
    Nejsem učitel. Přesto se ale o těch věcech můžu odvážit mluvit. Měl jste mě mimochodem nejprve ze všeho asi upozornit, že jsem u toho všeho „zapomněl“ na entalpii. Sice by to na podstatu nemělo vliv, ale měl jste. Tento výraz se u výměny energie a tepla velmi často používá, protože tam má své místo, A znělo by to od vás zasvěceněji.
    Co je to teplo, to je přinejmenším velmi snadno vyhledatelné na internetu. Stejně tak, co je to stavovská veličina. Není tedy snad nutno se o tom rozepisovat. Ale můžete mi věřit, že po dokončení rozpouštění je roztok opravdu v jiném energetickém stavu.
    Vrátíme se ještě naposledy k těm energiím při rozpouštění. Mřížka soli drží při sobě z jistých energetických důvodů. Při vzniku iontového roztoku (viz. ona zmíněná disociace), tedy při rozpouštění NaCl, je nutno vynaložit pro narušení vazeb ve mřížce energii. Tu, a to kinetickou, dodají ony ionty rozpouštědla, tedy vody. Voda, jakožto dipól, to umí. Ihned poté, kdy je ze mřížky uvolněn kterýkoliv iont, je hydratován, opět ionty rozpouštědla. Již jsme si o tom psali. Třebaže vám to nesedí, částicím, tedy iontům, poté již skutečně kinetická energie není předávaná tak, aby to mělo vliv na energetickou, potažmo tepelnou bilanci vznikajícího roztoku. Na ni má vliv pouze ta energie, která je předávaná iontům ve mřížce, aby ji mohly opustit. Předávaná energie ovšemže nepatří, přesněji nepatřila částicím (iontům) roztoku, ale skutečně iontům rozpouštědla, kterým je voda. V předchozích větách je uvedeno, proč tomu tak je. Co spolu všechny ionty poté, kdy došlo k rozrušení mřížky, a hydrataci provádějí, to nám pro bilanci už skutečně může být šumafuk. No, a že teplo vzniká prakticky u všech energetických výměn, tím by to doufám mohlo být ukončeno. Máte-li k tomu ovšem další poznatky podobného charakteru, již to přesahuje mou kapacitu.

  90. ind

    @Medea

    Žiadnu logickú chybu som neurobila.

    Ale ano, udělala jste. Chyba spočívá v tom, že spojujete pravděpodobnost uskutečnění děje s tím, co od daného děje očekáváte. A to je chyba.
    Dle očekávání můžete posloupnosti 100 čísel po hodu kostkou přiřadit extrémně malou pravděpodobnost, nebo také pravděpodobnost extrémně velkou.
    Pokud např. očekáváte, že vytvořená posloupnost bude v rámci lidstva unikátní, tzn. nikdo jiný ji ještě neuskutečnil ani neuskuteční, pak se to stane s extrémně velkou pravděpodobností.
    Tzn. něco se stalo a dle vlastních požadavků tomu můžete přiřadit extrémně malou nebo velkou pravděpodobnost, nebo i téměř 50%, pokud očekáváte, že dostanete více sudých čísel v posloupnosti, než lichých.

    Nedějí se běžně děje s extrémně nízkou pravděpodobností, pokud tuto pravděpodobnost vztáhnete k uskutečnění daného děje, ne k tomu, co od něj očekáváte.

    Už tu svou logickou chybu vidíte?

  91. ind

    @Ateistický laik

    ind: S tím rozsahem vědomostí nemáte pravdu.
    Ale má, dočtěte si ten článek do konce cituji: „I proto působí IBM Debater jako hotové zjevení, i když i on má své limity a zatím umí diskutovat jen o omezeném výčtu témat. “

    Omezený výčet témat k diskuzi má každý člověk, AI stroj je schopen mít tento výčet témat obsáhlejší.

  92. ind

    @Marek

    Pro mne je komunikace s vámi duševně vysilující, tak, jako všechny ostatní, jsou-li podobně bezvýsledné.

    Jaký výsledek byste očekával? Téma rozpouštění solí se žádným způsobem netýká ani ateismu, ani víry.

    Udivuje mne Inde, kde berete energii se s tolika lidmi vyloženě handrkovat. Má spekulace – pokud u svého boha, potom je ten lepší, než lithium-sírová baterie.

    Narozdíl od vás, nejsem vůbec unaven.

    Předávaná energie ovšemže nepatří, přesněji nepatřila částicím (iontům) roztoku, ale skutečně iontům rozpouštědla, kterým je voda.

    Zamyslete se znovu nad svým tvrzením o předávání kinetické energie pouze od rozpouštědla. Že by se ochlazovalo pouze rozpouštědlo, přitom rozpuštěná látka ne, tak tomu tak není. Pokud se ochlazuje i rozpouštěná látka, pak musí být předávána kinetická energie i od ní.

    Proto je přesnější hovořit o předávání kinetické energie částic roztoku, neboť se neochlazuje pouze rozpouštědlo, ale celý roztok. Máte vůči tomu nějaké námitky?

  93. ind

    @Medea

    Čo myslíte pod „funkčným kódom“ alebo pod „informačnou zložitosťou“?

    Funkční kód je kód, který není „junk“ (doslova), kód, který plní nějakou funkci.

    Informační složitostí jsem mínil složitost struktury dat. Tu lze zkoumat z různých hledisek – např. klesá entropie dat v závislosti na předchozích datech v kódu? Pokud ano, do jaké délky? Atd.

  94. ind

    @Jaroslav Štejfa

    Stále se vyznačujete neschopností postavit věrohodný model inteligence, která stvořila RNA a zároveň se vyhnout nekonečnému regresu.

    Ale nějaký model inteligence vůbec není kvůli zdůvodnění důležitý. Nejdříve je potřeba rozpoznat, zda je inteligence nutná a až pak zkoumat, kdo ona inteligence je.

  95. Ateistický laik

    ind: Omezený výčet témat k diskuzi má každý člověk, AI stroj je schopen mít tento výčet témat obsáhlejší.
    Ano, čím ho nahustíte, s tím se s váma bude „bavit“. Až bude mít tenhle počítač dostatečně tlustý kabel k internetu, tak to bude „génius“.
    Abych to nazval inteligencí, tak ten stroj by si měl asi uvědomit sám sebe, což asi v budoucnu se dá předpokládat a naprogramovat-nasimulovat se to určitě dá. Jen jsem zvědavej jak se bude rozmnožovat…

  96. ind

    @Ateistický laik

    Takhle se může rozmnožovat…

    Teď se systém AutoML opět dostal do zorného pole médií. V posledních měsících se věnuje inteligencím pro zpracování a rozpoznávání obrazu. Běžný uživatel webu jistě občas narazí na test, kde si webová stránka ověřuje, zda je člověk nebo robot, který chce provést něco nepěkného s daty. Zmíněný test obvykle spočívá v rozeznávání obrázků, protože v tom jsou lidé stále lepší než strojové inteligence.
    Přesněji řečeno, lidé v tom byli lepší až doposud. Jakmile se do celé záležitosti vložila inteligence AutoML, tak jsou zřejmě dny lidské nadvlády v tomto směru sečteny. Už teď prý AutoML pěstuje inteligence, které rozeznávají objekty lépe, než kterýkoliv stávající systém strojového vidění. Například, když se nový potomek systému AutoML jménem NASNet podívá na snímek osoby šplhající po hoře, tak s 82,7 procentní přesností rozliší klíčové prvky snímku – osobu, její vybavení, její batoh, oblaka, Slunce, atd.

    http://www.osel.cz/9693-nova-inteligence-google-umi-skvelou-vec-vychovava-potomky.html?typ=odpoved&id_prispevku=158534

  97. Ateistický laik

    @ ind: Až se střetne Watson spáří s Deep Blue tak vznikne takový malinkatý počítač s nadáním na šachy… 🙂

  98. Marek

    Rozpouštění, v tomto případě soli (NaCl) ve vodě, je Inde elementární, známý a vyčíslitelný jev. Jako příklad jsem jej, sice zbytečně, ale použil proto, abyste pochopil, že pokud někdo chce odborně posuzovat věci hned o mnoho stupňů složitější, je k tomu podmínkou naprosto nezbytnou, aby chápal ty banální. Znát do naprostých podrobností je nemusí, ale chápat, co tam probíhá, to ano.

    Ta výměna energií, kdo kam co dává, a kdo a kde si co bere, je na myšlení o malý kousek složitější. Nelze ale do toho vkládat osobní názory. Nebudu se již pokoušet dále vám ji objasňovat. Snad jen tolik, že při rozpouštění soli se ta polévka kromě jiného taky chutí stane slanou. Natolik vás nepodceňuji, že bych nevěřil, že toto chápete. Můžete tedy bádat, zda se na tom stavu chuťové slanosti podílela také přítomná voda, a jak to učinila. Dospějete-li k myšlence, že se voda, potažmo vzniklý roztok „přece“ také stane nositelem té slanosti, pak připomínám, že je to výsledek celého toho speciálního solicího projektu. Výsledek.

    Komunikace s vámi mne unavuje v tom samém smyslu, jako je unavující vědomí zbytečného konání. Třebaže se jedná o pouhý eufemismus, nazvu to celé vaší „neochotou“ alespoň náznakem pochopit, co je vám psáno. Té polévky už skutečně je zbytečně moc, navíc je přesolená. Chcete-li k tomu něco dodat, gou ehed, já ale už ne.

  99. Medea

    Žiadnu logickú chybu som neurobila.

    „Ale ano, udělala jste. Chyba spočívá v tom, že spojujete pravděpodobnost uskutečnění děje s tím, co od daného děje očekáváte. A to je chyba.“

    Ktovie, čo si Vy prestavujete pod „logikou“, Ind 🙂

    „Chyba spočívá v tom, že spojujete pravděpodobnost uskutečnění děje s tím, co od daného děje očekáváte. A to je chyba.“

    Ja od daného deja neočakávam nič, len konštatujem, že keď je istý jav zjednotením extrémne nepravdepodobných javov, tak pri pokuse nutne nastane nejaký extrémne nepravdedpodobný jav a uviedla som aj príklad, kde všetky elementárne javy sú extrémne nepravdepodobné.

    Bavíme sa o týchto mojich príspevkoch:

    „věřte si klidně v to, že nastal jev, který měl pravděpodobnost 0,0000000000000000000000000000001%“

    Ind, hoďte sto krát za sebou vyváženou kockou, a vygenerujete jav, ktorého pravdepodobnosť je 1.53… × 10^-78 🙂

    (Pomocou stonásobného hodu generujete reťazec čísel z {1, …, 6} s dĺžkou 100, takýchto reťazcov je 6^100, každý generovateľný s rovnakou pravdepodobnosťou.)

    Tým nechcem povedať, že samovoľný vznik života na Zemi má takúto pravdepodobnosť, len ukázať, že extrémne nepravdepodobné javy sú úplne bežné. Keď je istý jav zjednotením javov extrémne nepravdepodobných, tak pri každom vykonaní náhodného pokusu nastane jav extrémne nepravdepodobný.

    „Nedějí se běžně děje s extrémně nízkou pravděpodobností, pokud tuto pravděpodobnost vztáhnete k uskutečnění daného děje, ne k tomu, co od něj očekáváte.“

    Nezmysel. Vrhnite stonásobne vyváženou kockou a dostanete ako výsledok jav s pravdepodobnosťou 1/6^100. A vždy pri spomínanom pokuse nastane jav s takouto pravdepodobnosťou, pretože všetky stočlenné postupnosti, ktoré získate takýmto vrhaním, sú rovnako pravdepodobné a je ich 6^100. O očakávaniach nehovorím, hovorím, že nutne nastane NEJAKÝ extrémne nepravdepodobný (elementárny) jav pri tomto pokuse.

    A príroda ustavične vrhá kvantové kocky, teda k extrémne nepravdepodobným udalostiam dochádza neprestajne.

  100. antitheista

    Medeo, u nás v ČR je totiž zakázané tolikrát hodit kočkou, víš, my zde máme zákony proti týrání zvířat, ale jednou se to dostane i na Slovensko třeba 🙂

  101. antitheista

    Jinak souhlasím s tím, že i nepravděpodobné jevy se za dlouhý čas mohou stát, dokonce za nekonečný čas by to bylo i nutné, aby se staly i hodně nepravděpodobné (fyzikální) jevy. To je matematika. Ind to nechce chápat.

  102. Medea

    @Ind

    „Informační složitostí jsem mínil složitost struktury dat. Tu lze zkoumat z různých hledisek – např. klesá entropie dat v závislosti na předchozích datech v kódu? Pokud ano, do jaké délky? Atd.“

    Dajte nejakú definíciu.

  103. Jaroslav Štejfa

    K indovi:
    Cituji:
    Ale nějaký model inteligence vůbec není kvůli zdůvodnění důležitý. Nejdříve je potřeba rozpoznat, zda je inteligence nutná a až pak zkoumat, kdo ona inteligence je.

    Můj názor – nejdříve je skutečně potřeba rozpoznat, zda je inteligence ke vzniku života nutná či nikoliv. Vy tvrdíte, že ano, já, že ne. Takže to máme za sebou. Já ve prospěch svého názoru argumentuji převážným proudem souhlasného zkoumání exaktních věd, vy tím, že je nyní potřeba zkoumat, kdo ona inteligence je. Nuže hurá do toho, vždyť to se vás ptám (a nejsem sám) už drahnou dobu. Hlavně netvrďte že nějaký model inteligence není důležitý. Svatá prostoto.
    Jaroslav Štejfa

  104. Medea

    „Jinak souhlasím s tím, že i nepravděpodobné jevy se za dlouhý čas mohou stát, dokonce za nekonečný čas by to bylo i nutné, aby se staly i hodně nepravděpodobné (fyzikální) jevy.“

    Konečne je tu aj starý dobrý Antitheista 😀

    Antitheista, tu nejde o čas. Vezmi tú spomínanú vyváženú kocku a vrhni ňou stokrát, a okamžite máš nejaký jav s pravdepodobnosťou 1/6^100 (1.53… × 10^-78). Alebo náhodne vytiahni z urny, ktorá obsahuje trilión rovnakých guličiek (európsky „trilión“), jednu, a okamžite máš jav s pravdepodobnosťou 10^-18.

  105. antitheista

    No ano, ale jak říkám, u nás se kočkou házet tolikrát nesmí! 🙁

    Zkusil jsem teď kvůli tobě 3X hodit kočkou a po čtvrté mě už škrábla! Ale věřím ti!

  106. antitheista

    A také tě zdravím, Medeo! 🙂

  107. Medea

    „Ja od daného deja neočakávam nič, len konštatujem, že keď je istý jav zjednotením extrémne nepravdepodobných javov, tak pri pokuse nutne nastane nejaký extrémne nepravdedpodobný jav a uviedla som aj príklad, kde všetky elementárne javy sú extrémne nepravdepodobné.“

    Istý jav – jav, ktorý vždy nastane, v Kolmogorovovskej axiomatike mu zodpovedá nosič pravdepodobnostného priestoru – množina Ω.

  108. Medea

    @Ind

    „A vrchol absurdity je přesvědčovat mně pomocí nenulové pravděpodobnosti.“

    Ja Vám len pripomínam, čo všetko neviete. Neviete, aká bola pravdepodobnosť samovoľného vzniku života na pravekej Zemi, a neviete ani to, koľko bolo pred 4.5 miliardami rokov v našom vesmíre podobných planét (koľko nezávislých náhodných „pokusov“ v prírode pred miliardami rokov prebehlo).

  109. Medea

    @Ind

    Teda nepodarilo sa Vám určiť pravdepodobnosť samovoľného vzniku života na pravekej Zemi, nepodarilo sa Vám určiť, koľko takýchto, pravekej Zemi podobných planét bolo pred miliardami rokov v našom vesmíre. Teda rozhodne sa Vám nepodarilo dokázať nemožnosť samovoľného vzniku života v našom vesmíre (a pripomínam, že aj jav s nulovou pravdepodobnosťou môže byť možný) 🙂

    Neobhajujem v tejto diskusii evolučnú teóriu, len sa kriticky vyjadrujem k Vašim vyhláseniam, že téza o možnosti samovoľného vzniku života je absurdná alebo dokonca evidentne absurdná.

  110. Jaroslav Štejfa

    Potěšilo mě, že na některá témata se zde zase dá diskutovat, nebo se z diskuse poučit. Protože z mlčení nevyplývá souhlas či odpor jednoduše, proto moje poznámka. Díky.
    Jaroslav Štejfa

Napsat komentář

Vaše emailová adresa nebude zveřejněna. Vyžadované informace jsou označeny *